FABP4 (fatty acid binding protein 4)

Gene

• Entrez ID: 2167
• Gene name: Fatty acid binding protein 4
• Gene symbol: FABP4
• Synonyms (NCBI Gene): A-FABP, AFABP, ALBP, HEL-S-104, aP2
• Chromosome: 8
• Chromosome location: 8q21.13
• Summary: FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles inc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005490	hsa-miR-138-5p	qRT-PCR	20486779
MIRT005959	hsa-miR-369-5p	Luciferase reporter assay	21660946
MIRT019040	hsa-miR-335-5p	Microarray	18185580
MIRT005959	hsa-miR-369-5p	Reporter assay	21660946
MIRT736118	hsa-miR-455-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31638263
MIRT1548466	hsa-miR-935	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ASXL1	Unknown	21047783
FOXO1	Activation	20102700
PPARA	Unknown	19717768
PPARG	Activation	11574398
PPARG	Unknown	17322100;21047783

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IEA
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	ISS
GO:0005504	Function	Fatty acid binding	IBA
GO:0005504	Function	Fatty acid binding	TAS	2481498
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	2481498, 16130169
GO:0005811	Component	Lipid droplet	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0008289	Function	Lipid binding	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0015908	Process	Fatty acid transport	IBA
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0015909	Process	Long-chain fatty acid transport	ISS
GO:0036041	Function	Long-chain fatty acid binding	IEA
GO:0036041	Function	Long-chain fatty acid binding	ISS
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050872	Process	White fat cell differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0051427	Function	Hormone receptor binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071285	Process	Cellular response to lithium ion	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24603714

Other IDs

• MIM: 600434
• HGNC: 3559
• e!Ensembl: ENSG00000170323

Protein

• UniProt ID: P15090
• Protein name: Fatty acid-binding protein, adipocyte (Adipocyte lipid-binding protein) (ALBP) (Adipocyte-type fatty acid-binding protein) (A-FABP) (AFABP) (Fatty acid-binding protein 4)
• Protein function: Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.
• PDB: 1TOU, 1TOW, 2HNX, 2NNQ, 3FR2, 3FR4, 3FR5, 3P6C, 3P6D, 3P6E, 3P6F, 3P6G, 3P6H, 3Q6L, 3RZY, 4NNS, 4NNT, 5D45, 5D47, 5D48, 5D4A, 5EDB, 5EDC, 5HZ6, 5HZ8, 5Y0F, 5Y0G, 5Y0X, 5Y12, 5Y13, 6AYL, 6LJS, 6LJT, 6LJU, 6LJV, 6LJW, 6LJX, 7FVU, 7FVV, 7FVW, 7FVX, 7FVY, 7FVZ, 7FW0, 7FW1, 7FW2, 7FW3, 7FW4, 7FW5, 7FW6, 7FW7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	6 → 132	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Sequence:

  MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
  TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
  KGVTSTRVYERA

• Sequence length: 132

Pathways

KEGG:

PPAR signaling pathway
Regulation of lipolysis in adipocytes

Reactome:

Triglyceride catabolism
Transcriptional regulation of white adipocyte differentiation