Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2167
Gene name Gene Name - the full gene name approved by the HGNC.	Fatty acid binding protein 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FABP4
Synonyms (NCBI Gene) Gene synonyms aliases	A-FABP, AFABP, ALBP, HEL-S-104, aP2
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q21.13
Summary Summary of gene provided in NCBI Entrez Gene.	FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles inc

Show/Hide all(6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005490	hsa-miR-138-5p	qRT-PCR	20486779
MIRT005959	hsa-miR-369-5p	Luciferase reporter assay	21660946
MIRT019040	hsa-miR-335-5p	Microarray	18185580
MIRT005959	hsa-miR-369-5p	Reporter assay	21660946
MIRT736118	hsa-miR-455-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31638263
MIRT1548466	hsa-miR-935	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
ASXL1	Unknown	21047783
FOXO1	Activation	20102700
PPARA	Unknown	19717768
PPARG	Activation	11574398
PPARG	Unknown	17322100;21047783

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IEA
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	ISS
GO:0005504	Function	Fatty acid binding	IBA
GO:0005504	Function	Fatty acid binding	TAS	2481498
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	2481498, 16130169
GO:0005811	Component	Lipid droplet	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0008289	Function	Lipid binding	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0015908	Process	Fatty acid transport	IBA
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0015909	Process	Long-chain fatty acid transport	ISS
GO:0036041	Function	Long-chain fatty acid binding	IEA
GO:0036041	Function	Long-chain fatty acid binding	ISS
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050872	Process	White fat cell differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0051427	Function	Hormone receptor binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071285	Process	Cellular response to lithium ion	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24603714

MIM	HGNC	e!Ensembl
600434	3559	ENSG00000170323

Protein

UniProt ID

P15090

Protein name

Fatty acid-binding protein, adipocyte (Adipocyte lipid-binding protein) (ALBP) (Adipocyte-type fatty acid-binding protein) (A-FABP) (AFABP) (Fatty acid-binding protein 4)

Protein function

Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.

PDB

1TOU , 1TOW , 2HNX , 2NNQ , 3FR2 , 3FR4 , 3FR5 , 3P6C , 3P6D , 3P6E , 3P6F , 3P6G , 3P6H , 3Q6L , 3RZY , 4NNS , 4NNT , 5D45 , 5D47 , 5D48 , 5D4A , 5EDB , 5EDC , 5HZ6 , 5HZ8 , 5Y0F , 5Y0G , 5Y0X , 5Y12 , 5Y13 , 6AYL , 6LJS , 6LJT , 6LJU , 6LJV , 6LJW , 6LJX , 7FVU , 7FVV , 7FVW , 7FVX , 7FVY , 7FVZ , 7FW0 , 7FW1 , 7FW2 , 7FW3 , 7FW4 , 7FW5 , 7FW6 , 7FW7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	6 → 132	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Sequence

MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA

Sequence length

132

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Regulation of lipolysis in adipocytes		Triglyceride catabolism Transcriptional regulation of white adipocyte differentiation

FABP4 (fatty acid binding protein 4)