Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2166
Gene name Gene Name - the full gene name approved by the HGNC.	Fatty acid amide hydrolase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FAAH
Synonyms (NCBI Gene) Gene synonyms aliases	FAAH-1, FAAH1, PSAB
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide. [provided by RefSeq, Jul 2008]

Show/Hide all(126)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038079	hsa-miR-423-5p	CLASH	23622248
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT510260	hsa-miR-4459	PAR-CLIP	20371350
MIRT510259	hsa-miR-665	PAR-CLIP	20371350
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	20371350
MIRT510257	hsa-miR-4537	PAR-CLIP	20371350
MIRT510256	hsa-miR-6087	PAR-CLIP	20371350
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT510254	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT510253	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT510260	hsa-miR-4459	PAR-CLIP	20371350
MIRT510259	hsa-miR-665	PAR-CLIP	20371350
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	20371350
MIRT510257	hsa-miR-4537	PAR-CLIP	20371350
MIRT510256	hsa-miR-6087	PAR-CLIP	20371350
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT510254	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT510253	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT510260	hsa-miR-4459	PAR-CLIP	23446348
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT510257	hsa-miR-4537	PAR-CLIP	23446348
MIRT510256	hsa-miR-6087	PAR-CLIP	23446348
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT510254	hsa-miR-25-5p	PAR-CLIP	23446348
MIRT510253	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT519268	hsa-miR-1273e	PAR-CLIP	23446348
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT510260	hsa-miR-4459	PAR-CLIP	23446348
MIRT510259	hsa-miR-665	PAR-CLIP	23446348
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT510257	hsa-miR-4537	PAR-CLIP	23446348
MIRT510256	hsa-miR-6087	PAR-CLIP	23446348
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT510254	hsa-miR-25-5p	PAR-CLIP	23446348
MIRT510253	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT462042	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462043	hsa-miR-1321	PAR-CLIP	23592263
MIRT462041	hsa-miR-4739	PAR-CLIP	23592263
MIRT462040	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT462039	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT462038	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT462037	hsa-miR-4419a	PAR-CLIP	23592263
MIRT462036	hsa-miR-4510	PAR-CLIP	23592263
MIRT462035	hsa-miR-6127	PAR-CLIP	23592263
MIRT462033	hsa-miR-6129	PAR-CLIP	23592263
MIRT462034	hsa-miR-6130	PAR-CLIP	23592263
MIRT462032	hsa-miR-6133	PAR-CLIP	23592263
MIRT462031	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT462030	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT510260	hsa-miR-4459	PAR-CLIP	20371350
MIRT510259	hsa-miR-665	PAR-CLIP	20371350
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	20371350
MIRT510257	hsa-miR-4537	PAR-CLIP	20371350
MIRT510256	hsa-miR-6087	PAR-CLIP	20371350
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT510254	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT510253	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT510260	hsa-miR-4459	PAR-CLIP	20371350
MIRT510259	hsa-miR-665	PAR-CLIP	20371350
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	20371350
MIRT510257	hsa-miR-4537	PAR-CLIP	20371350
MIRT510256	hsa-miR-6087	PAR-CLIP	20371350
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT510254	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT510253	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT510260	hsa-miR-4459	PAR-CLIP	23446348
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT510257	hsa-miR-4537	PAR-CLIP	23446348
MIRT510256	hsa-miR-6087	PAR-CLIP	23446348
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT510254	hsa-miR-25-5p	PAR-CLIP	23446348
MIRT510253	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT519268	hsa-miR-1273e	PAR-CLIP	23446348
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT510260	hsa-miR-4459	PAR-CLIP	23446348
MIRT510259	hsa-miR-665	PAR-CLIP	23446348
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT510257	hsa-miR-4537	PAR-CLIP	23446348
MIRT510256	hsa-miR-6087	PAR-CLIP	23446348
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT510254	hsa-miR-25-5p	PAR-CLIP	23446348
MIRT510253	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT462042	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462043	hsa-miR-1321	PAR-CLIP	23592263
MIRT462041	hsa-miR-4739	PAR-CLIP	23592263
MIRT462040	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT462039	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT462038	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT462037	hsa-miR-4419a	PAR-CLIP	23592263
MIRT462036	hsa-miR-4510	PAR-CLIP	23592263
MIRT462035	hsa-miR-6127	PAR-CLIP	23592263
MIRT462033	hsa-miR-6129	PAR-CLIP	23592263
MIRT462034	hsa-miR-6130	PAR-CLIP	23592263
MIRT462032	hsa-miR-6133	PAR-CLIP	23592263
MIRT462031	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT462030	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT974851	hsa-miR-1266	CLIP-seq
MIRT974852	hsa-miR-198	CLIP-seq
MIRT974853	hsa-miR-3689d	CLIP-seq
MIRT974854	hsa-miR-4270	CLIP-seq
MIRT974855	hsa-miR-4441	CLIP-seq
MIRT974856	hsa-miR-4518	CLIP-seq
MIRT974857	hsa-miR-4534	CLIP-seq
MIRT974858	hsa-miR-4802-5p	CLIP-seq
MIRT974859	hsa-miR-510	CLIP-seq
MIRT974851	hsa-miR-1266	CLIP-seq
MIRT974852	hsa-miR-198	CLIP-seq
MIRT974853	hsa-miR-3689d	CLIP-seq
MIRT974854	hsa-miR-4270	CLIP-seq
MIRT974855	hsa-miR-4441	CLIP-seq
MIRT974856	hsa-miR-4518	CLIP-seq
MIRT2223234	hsa-miR-4785	CLIP-seq
MIRT974859	hsa-miR-510	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
STAT3	Activation	12556536

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004040	Function	Amidase activity	IBA
GO:0004040	Function	Amidase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005543	Function	Phospholipid binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0009062	Process	Fatty acid catabolic process	IBA
GO:0009062	Process	Fatty acid catabolic process	IDA	9122178
GO:0009062	Process	Fatty acid catabolic process	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016788	Function	Hydrolase activity, acting on ester bonds	IEA
GO:0017064	Function	Fatty acid amide hydrolase activity	EXP	17015445
GO:0017064	Function	Fatty acid amide hydrolase activity	IBA
GO:0017064	Function	Fatty acid amide hydrolase activity	IDA	9122178
GO:0017064	Function	Fatty acid amide hydrolase activity	IEA
GO:0017064	Function	Fatty acid amide hydrolase activity	ISS
GO:0019369	Process	Arachidonate metabolic process	TAS
GO:0031090	Component	Organelle membrane	IEA
GO:0031090	Component	Organelle membrane	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0047372	Function	Monoacylglycerol lipase activity	IEA
GO:0047372	Function	Monoacylglycerol lipase activity	ISS
GO:0052651	Process	Monoacylglycerol catabolic process	IEA
GO:0052651	Process	Monoacylglycerol catabolic process	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150036	Process	Regulation of trans-synaptic signaling by endocannabinoid, modulating synaptic transmission	IEA

MIM	HGNC	e!Ensembl
602935	3553	ENSG00000117480

Protein

UniProt ID

O00519

Protein name

Fatty-acid amide hydrolase 1 (EC 3.5.1.99) (Anandamide amidohydrolase 1) (Fatty acid ester hydrolase) (EC 3.1.1.-) (Oleamide hydrolase 1)

Protein function

Catalyzes the hydrolysis of endogenous amidated lipids like the sleep-inducing lipid oleamide ((9Z)-octadecenamide), the endocannabinoid anandamide (N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine), as well as other fatty amides, to their corres

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01425	Amidase	95 → 562	Amidase	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the brain, small intestine, pancreas, skeletal muscle and testis. Also expressed in the kidney, liver, lung, placenta and prostate. {ECO:0000269|PubMed:17015445}.

Sequence

MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS

Sequence length

579

Interactions

View interactions

	KEGG		Reactome
	Retrograde endocannabinoid signaling		Arachidonic acid metabolism

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Psoriasis	Psoriasis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (65)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abdominal Pain	Associate	17962356
Abortion Habitual	Associate	11390466
Adenocarcinoma	Associate	18566995
Alcoholism	Associate	27716956, 28150397
Alzheimer Disease	Associate	14657172, 33810505
Alzheimer Disease	Stimulate	22720070
Anorexia Nervosa	Associate	19659925
Antisocial Personality Disorder	Inhibit	33462180
Antisocial Personality Disorder	Associate	35064143
Anxiety	Associate	19103437, 27005594, 27716956, 31184938, 34496065, 35944262, 37222214
Anxiety	Inhibit	34496065
Anxiety Disorders	Associate	26036940, 30929760, 34496065
Anxiety Disorders	Inhibit	34496065
Attention Deficit Disorder with Hyperactivity	Associate	31377429
Bicuspid Aortic Valve Disease	Associate	36071494
Borderline Personality Disorder	Associate	32521537, 35064143
Brain Injuries	Associate	22832737
Breast Neoplasms	Associate	23347118, 23374458
Bulimia Nervosa	Associate	19659925
Carcinoma Pancreatic Ductal	Associate	17943729
Carcinoma Renal Cell	Associate	37024452
Chronic Pain	Associate	30929760
Colitis Ulcerative	Associate	22662201, 34531823
Colonic Neoplasms	Associate	28850633
Colorectal Neoplasms	Associate	28850633
Depressive Disorder	Associate	27005594, 37222214, 38139281
Disruptive Impulse Control and Conduct Disorders	Associate	19103437
Drug Related Side Effects and Adverse Reactions	Associate	34871222
Dyslipidemias	Associate	19958092
Gastrointestinal Diseases	Associate	17962356
Glioblastoma	Associate	21156036
Glioma	Inhibit	22176552
Headache Disorders Secondary	Inhibit	40599037
Hereditary leiomyomatosis and renal cell cancer	Inhibit	30842391
Hereditary Sensory and Autonomic Neuropathies	Associate	32807182
Ichthyosis Bullosa of Siemens	Associate	17962356
Inflammation	Associate	33810505
Irritable Bowel Syndrome	Inhibit	24386448
Leiomyoma	Inhibit	30842391
Marijuana Abuse	Associate	34171108
Mental Disorders	Associate	31377429, 32521537
Multiple Sclerosis	Associate	17329437
Myocardial Infarction	Associate	25270105
Neoplasm Metastasis	Stimulate	36702852
Neoplasms	Associate	20808855, 23374458, 32968163, 36702852, 40630945
Neurologic Manifestations	Associate	37222214
Obesity	Associate	16186383, 19103437, 19958092, 20044928, 20054193, 20098695, 21118518, 21477106, 26561012, 32732136, 39940809
Obesity	Inhibit	24616451
Overweight	Associate	21477106
Pain	Associate	34283174, 37222214
Pain Insensitivity Congenital	Associate	30929760, 37222214
Pain Postoperative	Associate	30929760
Paine syndrome	Associate	34283174
Personality Disorders	Associate	33462180
Plaque Amyloid	Associate	14657172
Polycystic Ovary Syndrome	Inhibit	28132572
Propping Zerres syndrome	Associate	20054193
Prostatic Neoplasms	Associate	18566995, 20808855
Prostatitis	Associate	18566995
Stiff Person Syndrome	Associate	22776995
Stomach Neoplasms	Associate	36702852
Stress Disorders Post Traumatic	Associate	22832737, 27716956, 33729738, 35105857
Substance Related Disorders	Associate	19103437, 26036940
Tertiary Lymphoid Structures	Stimulate	23374458
Wounds and Injuries	Associate	27005594, 35944262

FAAH (fatty acid amide hydrolase)