Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
215
Gene name Gene Name - the full gene name approved by the HGNC.
ATP binding cassette subfamily D member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ABCD1
Synonyms (NCBI Gene) Gene synonyms aliases
ABC42, ALD, ALDP, AMN
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq28
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, M
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs4010613 C>A,T Pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs11146842 G>A Pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs128624214 C>G Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs128624215 C>G,T Likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs128624219 G>A Pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029416 hsa-miR-26b-5p Microarray 19088304
MIRT050424 hsa-miR-23a-3p CLASH 23622248
MIRT039787 hsa-miR-615-3p CLASH 23622248
MIRT053394 hsa-miR-96-5p Microarray 23807165
MIRT758715 hsa-miR-1202 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000038 Process Very long-chain fatty acid metabolic process IDA 29397936
GO:0000038 Process Very long-chain fatty acid metabolic process IEA
GO:0000166 Function Nucleotide binding IEA
GO:0002082 Process Regulation of oxidative phosphorylation IEA
GO:0002082 Process Regulation of oxidative phosphorylation ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300371 61 ENSG00000101986
Protein
UniProt ID P33897
Protein name ATP-binding cassette sub-family D member 1 (EC 3.1.2.-) (EC 7.6.2.-) (Adrenoleukodystrophy protein) (ALDP)
Protein function ATP-dependent transporter of the ATP-binding cassette (ABC) family involved in the transport of very long chain fatty acid (VLCFA)-CoA from the cytosol to the peroxisome lumen (PubMed:11248239, PubMed:15682271, PubMed:16946495, PubMed:18757502,
PDB 7RR9 , 7RRA , 7SHM , 7SHN , 7VR1 , 7VWC , 7VX8 , 7VZB , 7X07 , 7X0T , 7X0Z , 7X1W , 7XEC , 7YRQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06472 ABC_membrane_2 78 352 ABC transporter transmembrane region 2 Family
PF00005 ABC_tran 490 633 ABC transporter Domain
Sequence
MPVLSRPRPWRGNTLKRTAVLLALAAYGAHKVYPLVRQCLAPARGLQAPAGEPTQEASGV
AAAKAGMNRVFLQRLLWLLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVARLDGRLAR
CIVRKDPRAFGWQLLQWLLIALPATFVNSAIRYLEGQLALSFRSRLVAHAYRLYFSQQTY
YRVSNMDGRLRNPDQSLTEDVVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGT
AWPSAIAGLVVFLTANVLRAFSPKFGELVAEEARRKGELRYMHSRVVANSEEIAFYGGHE
VELALLQRSYQDLASQINLILLERLWYVMLEQFLMKYVWSASGLLMVAVPII
TATGYSES
DAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVH
EMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIP
IVTPSGEVVVASLNIRVEEGMHLLITGPNGCGKSSLFRILGGLWPTYGGVLYKPPPQRMF
YIPQRPYMSVGSLRDQVIYPDSVEDMQRKGYSEQDLEAILDVVHLHHILQREGGWEAMCD
WKDVLSGGEKQRIGMARMFYHRPKYALLDECTS
AVSIDVEGKIFQAAKDAGIALLSITHR
PSLWKYHTHLLQFDGEGGWKFEKLDSAARLSLTEEKQRLEQQLAGIPKMQRRLQELCQIL
GEAVAPAHVPAPSPQGPGGLQGAST
Sequence length 745
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  ABC transporters
Peroxisome
  ABC transporters in lipid homeostasis
Linoleic acid (LA) metabolism
alpha-linolenic acid (ALA) metabolism
Beta-oxidation of very long chain fatty acids
Defective ABCD1 causes adrenoleukodystrophy (ALD)
Class I peroxisomal membrane protein import
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Adrenoleukodystrophy adrenoleukodystrophy rs1064793877, rs1603232237, rs1292006620, rs1569541009, rs1603231653, rs1557055392, rs193922097, rs782509393, rs2091727061, rs128624218, rs1603235901, rs1557052555, rs713993050, rs1131691916, rs1569541096
View all (125 more)
N/A
Kyphoscoliotic Ehlers-Danlos Syndrome Ehlers-Danlos syndrome, kyphoscoliotic type 1 rs1557054873 N/A
Spondyloepimetaphyseal Dysplasia, X-Linked x-linked spondyloepimetaphyseal dysplasia rs128624224, rs128624218 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cerebral Adrenoleukodystrophy, X-Linked x-linked cerebral adrenoleukodystrophy N/A N/A ClinVar
Mental retardation intellectual disability N/A N/A ClinVar
Spastic Paraplegia hereditary spastic paraplegia N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Addison Disease Associate 21264817, 32207279, 36175155, 36983033
Adrenal Gland Diseases Associate 34445349
Adrenal Insufficiency Associate 20228476, 31777199, 32207279
Adrenoleukodystrophy Associate 10068511, 10068516, 11992258, 12065405, 17498713, 17602313, 17609205, 19787628, 20166112, 20228476, 20661612, 21264817, 21966424, 22045812, 22253809
View all (97 more)
Bipolar Disorder Associate 40142297
Brain Diseases Associate 22687851, 24719134
Carcinogenesis Associate 19787628
Carcinoma Renal Cell Inhibit 19787628
Carcinoma Renal Cell Associate 38297313
Cerebral Arterial Diseases Associate 23036268, 29136088