Gene Gene information from NCBI Gene database.
Entrez ID 2149
Gene name Coagulation factor II thrombin receptor
Gene symbol F2R
Synonyms (NCBI Gene)
CF2RHTRPAR-1PAR1TR
Chromosome 5
Chromosome location 5q13.3
Summary Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results i
miRNA miRNA information provided by mirtarbase database.
355
miRTarBase ID miRNA Experiments Reference
MIRT052570 hsa-let-7a-5p CLASH 23622248
MIRT037083 hsa-miR-877-3p CLASH 23622248
MIRT706041 hsa-miR-186-3p HITS-CLIP 22927820
MIRT706040 hsa-miR-150-5p HITS-CLIP 22927820
MIRT706039 hsa-miR-3653-5p HITS-CLIP 22927820
Transcription factors Transcription factors information provided by TRRUST V2 database.
6
Transcription factor Regulation Reference
SP1 Unknown 9494121
SP3 Unknown 9494121
STAT3 Activation 23504318
TFAP2A Unknown 20805990
TWIST1 Repression 19051271
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
94
GO ID Ontology Definition Evidence Reference
GO:0001965 Function G-protein alpha-subunit binding IEA
GO:0001965 Function G-protein alpha-subunit binding ISS
GO:0002248 Process Connective tissue replacement involved in inflammatory response wound healing IDA 9639571
GO:0003105 Process Negative regulation of glomerular filtration ISS
GO:0004930 Function G protein-coupled receptor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
187930 3537 ENSG00000181104
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P25116
Protein name Proteinase-activated receptor 1 (PAR-1) (Coagulation factor II receptor) (Thrombin receptor)
Protein function High affinity receptor that binds the activated thrombin, leading to calcium release from intracellular stores (PubMed:1672265, PubMed:8136362). The thrombin-activated receptor signaling pathway is mediated through PTX-insensitive G proteins, ac
PDB 1NRN , 1NRO , 1NRP , 1NRQ , 1NRR , 3BEF , 3HKI , 3HKJ , 3LU9 , 3VW7 , 8XOR , 8XOS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 119 371 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Platelets and vascular endothelial cells.
Sequence
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIY
YYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
Sequence length 425
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Complement and coagulation cascades
Platelet activation
Regulation of actin cytoskeleton
Pathogenic Escherichia coli infection
Pathways in cancer
  Common Pathway of Fibrin Clot Formation
Peptide ligand-binding receptors
G alpha (q) signalling events
Thrombin signalling through proteinase activated receptors (PARs)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
F2R-related disorder Benign rs2227745 RCV003922149
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 22459907
Adenocarcinoma Associate 33932087
Adenocarcinoma of Lung Associate 12548614, 20445954
Anemia Hemolytic Associate 6302135
Anemia Refractory Associate 8395910
Arthritis Rheumatoid Associate 18787303
Atherosclerosis Associate 12805069, 23740526, 35742805, 36430902
Atrial Fibrillation Associate 28747025
Autism Spectrum Disorder Associate 33442040
Blood Coagulation Disorders Associate 24973402, 26278396, 30891029, 34235728