Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2149
Gene name Gene Name - the full gene name approved by the HGNC.	Coagulation factor II thrombin receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	F2R
Synonyms (NCBI Gene) Gene synonyms aliases	CF2R, HTR, PAR-1, PAR1, TR
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results i

Show/Hide all(355)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052570	hsa-let-7a-5p	CLASH	23622248
MIRT037083	hsa-miR-877-3p	CLASH	23622248
MIRT706041	hsa-miR-186-3p	HITS-CLIP	22927820
MIRT706040	hsa-miR-150-5p	HITS-CLIP	22927820
MIRT706039	hsa-miR-3653-5p	HITS-CLIP	22927820
MIRT706038	hsa-miR-1976	HITS-CLIP	22927820
MIRT706037	hsa-miR-6790-3p	HITS-CLIP	22927820
MIRT706036	hsa-miR-6821-3p	HITS-CLIP	22927820
MIRT706035	hsa-miR-6778-3p	HITS-CLIP	22927820
MIRT706034	hsa-miR-1193	HITS-CLIP	22927820
MIRT706033	hsa-miR-378a-5p	HITS-CLIP	22927820
MIRT706032	hsa-miR-640	HITS-CLIP	22927820
MIRT706031	hsa-miR-6843-3p	HITS-CLIP	22927820
MIRT706030	hsa-miR-6848-3p	HITS-CLIP	22927820
MIRT571222	hsa-miR-3609	PAR-CLIP	20371350
MIRT571221	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT216663	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT216664	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT216660	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT216661	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT216667	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT216671	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT216670	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT216662	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT571220	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT216674	hsa-miR-33b-3p	PAR-CLIP	20371350
MIRT216668	hsa-miR-515-3p	PAR-CLIP	20371350
MIRT216669	hsa-miR-519e-3p	PAR-CLIP	20371350
MIRT216681	hsa-miR-3659	PAR-CLIP	20371350
MIRT216686	hsa-miR-4706	PAR-CLIP	20371350
MIRT216687	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT571219	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT216678	hsa-miR-3153	PAR-CLIP	20371350
MIRT216690	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT216692	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT216682	hsa-miR-4466	PAR-CLIP	20371350
MIRT216676	hsa-miR-675-5p	PAR-CLIP	20371350
MIRT706041	hsa-miR-186-3p	HITS-CLIP	22927820
MIRT706040	hsa-miR-150-5p	HITS-CLIP	22927820
MIRT706039	hsa-miR-3653-5p	HITS-CLIP	22927820
MIRT706038	hsa-miR-1976	HITS-CLIP	22927820
MIRT706037	hsa-miR-6790-3p	HITS-CLIP	22927820
MIRT706036	hsa-miR-6821-3p	HITS-CLIP	22927820
MIRT706035	hsa-miR-6778-3p	HITS-CLIP	22927820
MIRT706034	hsa-miR-1193	HITS-CLIP	22927820
MIRT706033	hsa-miR-378a-5p	HITS-CLIP	22927820
MIRT706032	hsa-miR-640	HITS-CLIP	22927820
MIRT706031	hsa-miR-6843-3p	HITS-CLIP	22927820
MIRT706030	hsa-miR-6848-3p	HITS-CLIP	22927820
MIRT571222	hsa-miR-3609	PAR-CLIP	20371350
MIRT571221	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT216663	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT216664	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT216660	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT216661	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT216667	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT216671	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT216670	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT216662	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT571220	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT216674	hsa-miR-33b-3p	PAR-CLIP	20371350
MIRT216668	hsa-miR-515-3p	PAR-CLIP	20371350
MIRT216669	hsa-miR-519e-3p	PAR-CLIP	20371350
MIRT216681	hsa-miR-3659	PAR-CLIP	20371350
MIRT216686	hsa-miR-4706	PAR-CLIP	20371350
MIRT216687	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT571219	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT216678	hsa-miR-3153	PAR-CLIP	20371350
MIRT216690	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT216692	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT216682	hsa-miR-4466	PAR-CLIP	20371350
MIRT216676	hsa-miR-675-5p	PAR-CLIP	20371350
MIRT974316	hsa-miR-106a	CLIP-seq
MIRT974317	hsa-miR-106b	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT974319	hsa-miR-150	CLIP-seq
MIRT974320	hsa-miR-17	CLIP-seq
MIRT974321	hsa-miR-1825	CLIP-seq
MIRT974322	hsa-miR-20a	CLIP-seq
MIRT974323	hsa-miR-20b	CLIP-seq
MIRT974324	hsa-miR-2115	CLIP-seq
MIRT974325	hsa-miR-2392	CLIP-seq
MIRT974326	hsa-miR-302a	CLIP-seq
MIRT974327	hsa-miR-302b	CLIP-seq
MIRT974328	hsa-miR-302c	CLIP-seq
MIRT974329	hsa-miR-302d	CLIP-seq
MIRT974330	hsa-miR-302e	CLIP-seq
MIRT974331	hsa-miR-3074-3p	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT974333	hsa-miR-3152-3p	CLIP-seq
MIRT974334	hsa-miR-3176	CLIP-seq
MIRT974335	hsa-miR-3182	CLIP-seq
MIRT974336	hsa-miR-361-5p	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT974338	hsa-miR-372	CLIP-seq
MIRT974339	hsa-miR-373	CLIP-seq
MIRT974340	hsa-miR-3922-3p	CLIP-seq
MIRT974341	hsa-miR-3942-3p	CLIP-seq
MIRT974342	hsa-miR-4263	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT974345	hsa-miR-4438	CLIP-seq
MIRT974346	hsa-miR-4506	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT974348	hsa-miR-4652-3p	CLIP-seq
MIRT974349	hsa-miR-4659a-3p	CLIP-seq
MIRT974350	hsa-miR-4659b-3p	CLIP-seq
MIRT974351	hsa-miR-4662a-5p	CLIP-seq
MIRT974352	hsa-miR-4676-5p	CLIP-seq
MIRT974353	hsa-miR-4731-5p	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT974355	hsa-miR-5095	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT974357	hsa-miR-512-3p	CLIP-seq
MIRT974358	hsa-miR-516a-3p	CLIP-seq
MIRT974359	hsa-miR-519d	CLIP-seq
MIRT974360	hsa-miR-520a-3p	CLIP-seq
MIRT974361	hsa-miR-520b	CLIP-seq
MIRT974362	hsa-miR-520c-3p	CLIP-seq
MIRT974363	hsa-miR-520d-3p	CLIP-seq
MIRT974364	hsa-miR-520e	CLIP-seq
MIRT974365	hsa-miR-520g	CLIP-seq
MIRT974366	hsa-miR-520h	CLIP-seq
MIRT974367	hsa-miR-548aa	CLIP-seq
MIRT974368	hsa-miR-575	CLIP-seq
MIRT974369	hsa-miR-576-5p	CLIP-seq
MIRT974370	hsa-miR-587	CLIP-seq
MIRT974371	hsa-miR-621	CLIP-seq
MIRT974372	hsa-miR-93	CLIP-seq
MIRT974316	hsa-miR-106a	CLIP-seq
MIRT974317	hsa-miR-106b	CLIP-seq
MIRT1556325	hsa-miR-1284	CLIP-seq
MIRT974320	hsa-miR-17	CLIP-seq
MIRT974322	hsa-miR-20a	CLIP-seq
MIRT974323	hsa-miR-20b	CLIP-seq
MIRT1556326	hsa-miR-217	CLIP-seq
MIRT1556327	hsa-miR-4418	CLIP-seq
MIRT1556328	hsa-miR-4793-3p	CLIP-seq
MIRT1556329	hsa-miR-509-3-5p	CLIP-seq
MIRT1556330	hsa-miR-509-5p	CLIP-seq
MIRT974359	hsa-miR-519d	CLIP-seq
MIRT1556331	hsa-miR-519e	CLIP-seq
MIRT1556332	hsa-miR-548ah	CLIP-seq
MIRT974372	hsa-miR-93	CLIP-seq
MIRT974325	hsa-miR-2392	CLIP-seq
MIRT974333	hsa-miR-3152-3p	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT974351	hsa-miR-4662a-5p	CLIP-seq
MIRT974352	hsa-miR-4676-5p	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT974368	hsa-miR-575	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT1988678	hsa-miR-154	CLIP-seq
MIRT1988679	hsa-miR-23a	CLIP-seq
MIRT1988680	hsa-miR-23b	CLIP-seq
MIRT1988681	hsa-miR-23c	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT1988682	hsa-miR-3199	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT1988683	hsa-miR-450b-5p	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT1988684	hsa-miR-4715-3p	CLIP-seq
MIRT1988685	hsa-miR-4722-3p	CLIP-seq
MIRT1988686	hsa-miR-4729	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT1988688	hsa-miR-4740-3p	CLIP-seq
MIRT1988689	hsa-miR-4763-5p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT1988691	hsa-miR-507	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT1988692	hsa-miR-550a	CLIP-seq
MIRT1988693	hsa-miR-552	CLIP-seq
MIRT1988694	hsa-miR-557	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT1988696	hsa-miR-764	CLIP-seq
MIRT2223102	hsa-miR-1267	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT2223103	hsa-miR-1281	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT2223104	hsa-miR-1307	CLIP-seq
MIRT2223105	hsa-miR-1343	CLIP-seq
MIRT974325	hsa-miR-2392	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT1988682	hsa-miR-3199	CLIP-seq
MIRT2223106	hsa-miR-338-5p	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT2223107	hsa-miR-4284	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT2223108	hsa-miR-4534	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT2223109	hsa-miR-4638-5p	CLIP-seq
MIRT1988685	hsa-miR-4722-3p	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT1988688	hsa-miR-4740-3p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT2223110	hsa-miR-4803	CLIP-seq
MIRT2223111	hsa-miR-548ac	CLIP-seq
MIRT2223112	hsa-miR-548ae	CLIP-seq
MIRT2223113	hsa-miR-548aj	CLIP-seq
MIRT2223114	hsa-miR-548am	CLIP-seq
MIRT2223115	hsa-miR-548d-3p	CLIP-seq
MIRT2223116	hsa-miR-548x	CLIP-seq
MIRT2223117	hsa-miR-548z	CLIP-seq
MIRT1988693	hsa-miR-552	CLIP-seq
MIRT2223118	hsa-miR-582-5p	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT2223119	hsa-miR-624	CLIP-seq
MIRT974316	hsa-miR-106a	CLIP-seq
MIRT974317	hsa-miR-106b	CLIP-seq
MIRT2526986	hsa-miR-1245b-5p	CLIP-seq
MIRT2526987	hsa-miR-1248	CLIP-seq
MIRT2526988	hsa-miR-1254	CLIP-seq
MIRT2526989	hsa-miR-1266	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT2526990	hsa-miR-1289	CLIP-seq
MIRT2526991	hsa-miR-1291	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT2526992	hsa-miR-1301	CLIP-seq
MIRT2526993	hsa-miR-147	CLIP-seq
MIRT974319	hsa-miR-150	CLIP-seq
MIRT974320	hsa-miR-17	CLIP-seq
MIRT974322	hsa-miR-20a	CLIP-seq
MIRT974323	hsa-miR-20b	CLIP-seq
MIRT2526994	hsa-miR-28-3p	CLIP-seq
MIRT974326	hsa-miR-302a	CLIP-seq
MIRT974327	hsa-miR-302b	CLIP-seq
MIRT974328	hsa-miR-302c	CLIP-seq
MIRT974329	hsa-miR-302d	CLIP-seq
MIRT974330	hsa-miR-302e	CLIP-seq
MIRT2526995	hsa-miR-3116	CLIP-seq
MIRT2526996	hsa-miR-3130-5p	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT2526997	hsa-miR-3140-3p	CLIP-seq
MIRT2526998	hsa-miR-3142	CLIP-seq
MIRT2526999	hsa-miR-3180	CLIP-seq
MIRT2527000	hsa-miR-3180-3p	CLIP-seq
MIRT2527001	hsa-miR-3196	CLIP-seq
MIRT2527002	hsa-miR-3198	CLIP-seq
MIRT2527003	hsa-miR-328	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT2527004	hsa-miR-346	CLIP-seq
MIRT2527005	hsa-miR-3622b-5p	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT2527006	hsa-miR-3664-3p	CLIP-seq
MIRT2527007	hsa-miR-3664-5p	CLIP-seq
MIRT2527008	hsa-miR-3681	CLIP-seq
MIRT2527009	hsa-miR-3691-5p	CLIP-seq
MIRT974338	hsa-miR-372	CLIP-seq
MIRT974339	hsa-miR-373	CLIP-seq
MIRT974341	hsa-miR-3942-3p	CLIP-seq
MIRT2527010	hsa-miR-3945	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT2527011	hsa-miR-4253	CLIP-seq
MIRT2527012	hsa-miR-4254	CLIP-seq
MIRT2527013	hsa-miR-4266	CLIP-seq
MIRT2527014	hsa-miR-4288	CLIP-seq
MIRT2527015	hsa-miR-4294	CLIP-seq
MIRT2527016	hsa-miR-4297	CLIP-seq
MIRT2527017	hsa-miR-4309	CLIP-seq
MIRT2527018	hsa-miR-4312	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT2527019	hsa-miR-4482	CLIP-seq
MIRT2527020	hsa-miR-4488	CLIP-seq
MIRT1988683	hsa-miR-450b-5p	CLIP-seq
MIRT2527021	hsa-miR-4518	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT2527022	hsa-miR-4643	CLIP-seq
MIRT2527023	hsa-miR-4650-5p	CLIP-seq
MIRT2527024	hsa-miR-4660	CLIP-seq
MIRT2527025	hsa-miR-4691-5p	CLIP-seq
MIRT2527026	hsa-miR-4695-5p	CLIP-seq
MIRT2527027	hsa-miR-4697-5p	CLIP-seq
MIRT2527028	hsa-miR-4711-3p	CLIP-seq
MIRT2527029	hsa-miR-4714-5p	CLIP-seq
MIRT1988684	hsa-miR-4715-3p	CLIP-seq
MIRT2527030	hsa-miR-4720-5p	CLIP-seq
MIRT974353	hsa-miR-4731-5p	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT2527031	hsa-miR-4766-5p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT2527032	hsa-miR-4779	CLIP-seq
MIRT2527033	hsa-miR-4787-5p	CLIP-seq
MIRT2527034	hsa-miR-4799-3p	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT2527035	hsa-miR-494	CLIP-seq
MIRT2527036	hsa-miR-5047	CLIP-seq
MIRT1988691	hsa-miR-507	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT974357	hsa-miR-512-3p	CLIP-seq
MIRT974359	hsa-miR-519d	CLIP-seq
MIRT974360	hsa-miR-520a-3p	CLIP-seq
MIRT974361	hsa-miR-520b	CLIP-seq
MIRT974362	hsa-miR-520c-3p	CLIP-seq
MIRT974363	hsa-miR-520d-3p	CLIP-seq
MIRT974364	hsa-miR-520e	CLIP-seq
MIRT974365	hsa-miR-520g	CLIP-seq
MIRT974366	hsa-miR-520h	CLIP-seq
MIRT2527037	hsa-miR-532-5p	CLIP-seq
MIRT1988694	hsa-miR-557	CLIP-seq
MIRT2527038	hsa-miR-576-3p	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT2527039	hsa-miR-599	CLIP-seq
MIRT2527040	hsa-miR-606	CLIP-seq
MIRT2527041	hsa-miR-632	CLIP-seq
MIRT2527042	hsa-miR-642b	CLIP-seq
MIRT2527043	hsa-miR-661	CLIP-seq
MIRT2527044	hsa-miR-873	CLIP-seq
MIRT974372	hsa-miR-93	CLIP-seq
MIRT2526988	hsa-miR-1254	CLIP-seq
MIRT2526990	hsa-miR-1289	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT2526994	hsa-miR-28-3p	CLIP-seq
MIRT2526995	hsa-miR-3116	CLIP-seq
MIRT2526996	hsa-miR-3130-5p	CLIP-seq
MIRT2527002	hsa-miR-3198	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT2527004	hsa-miR-346	CLIP-seq
MIRT2527008	hsa-miR-3681	CLIP-seq
MIRT2527009	hsa-miR-3691-5p	CLIP-seq
MIRT974341	hsa-miR-3942-3p	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT2527012	hsa-miR-4254	CLIP-seq
MIRT2527014	hsa-miR-4288	CLIP-seq
MIRT2527015	hsa-miR-4294	CLIP-seq
MIRT2527017	hsa-miR-4309	CLIP-seq
MIRT2527019	hsa-miR-4482	CLIP-seq
MIRT1988683	hsa-miR-450b-5p	CLIP-seq
MIRT2527025	hsa-miR-4691-5p	CLIP-seq
MIRT2527028	hsa-miR-4711-3p	CLIP-seq
MIRT1988684	hsa-miR-4715-3p	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT1988691	hsa-miR-507	CLIP-seq
MIRT1988694	hsa-miR-557	CLIP-seq
MIRT2527038	hsa-miR-576-3p	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT2527040	hsa-miR-606	CLIP-seq
MIRT2527041	hsa-miR-632	CLIP-seq
MIRT2527043	hsa-miR-661	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
SP1	Unknown	9494121
SP3	Unknown	9494121
STAT3	Activation	23504318
TFAP2A	Unknown	20805990
TWIST1	Repression	19051271
TWIST2	Repression	19051271

Show/Hide all(94)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0001965	Function	G-protein alpha-subunit binding	ISS
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	IDA	9639571
GO:0003105	Process	Negative regulation of glomerular filtration	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	ISS
GO:0004930	Function	G protein-coupled receptor activity	TAS	17848177
GO:0005102	Function	Signaling receptor binding	IPI	1672265
GO:0005515	Function	Protein binding	IPI	17299037, 17848177, 20164183, 20826780, 22547407, 24732013
GO:0005576	Component	Extracellular region	TAS
GO:0005769	Component	Early endosome	IDA	22547407, 24732013
GO:0005770	Component	Late endosome	IDA	24732013
GO:0005794	Component	Golgi apparatus	TAS	7961693
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9038223, 22547407
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	1672265
GO:0005901	Component	Caveola	IDA	17848177
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	20164183
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007529	Process	Establishment of synaptic specificity at neuromuscular junction	ISS
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10692450
GO:0009611	Process	Response to wounding	IDA	9639571
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9701242
GO:0009986	Component	Cell surface	IDA	24732013
GO:0014047	Process	Glutamate secretion	ISS
GO:0015057	Function	Thrombin-activated receptor activity	IBA
GO:0015057	Function	Thrombin-activated receptor activity	IDA	1672265, 10692450
GO:0015057	Function	Thrombin-activated receptor activity	IEA
GO:0015057	Function	Thrombin-activated receptor activity	TAS	9038223
GO:0016020	Component	Membrane	IEA
GO:0030168	Process	Platelet activation	IDA	9038223
GO:0030193	Process	Regulation of blood coagulation	IDA	17848177
GO:0030194	Process	Positive regulation of blood coagulation	IBA
GO:0030194	Process	Positive regulation of blood coagulation	IDA	9038223
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	9701242
GO:0031094	Component	Platelet dense tubular network	IDA	9038223
GO:0031594	Component	Neuromuscular junction	ISS
GO:0031681	Function	G-protein beta-subunit binding	IEA
GO:0031681	Function	G-protein beta-subunit binding	ISS
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032651	Process	Regulation of interleukin-1 beta production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	11447194
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	17404307
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	9639571
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IEA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	ISS
GO:0036145	Process	Dendritic cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	10692450
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	17848177
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0045211	Component	Postsynaptic membrane	ISS
GO:0045217	Process	Cell-cell junction maintenance	IMP	23202369
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	17848177
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	ISS
GO:0045987	Process	Positive regulation of smooth muscle contraction	ISS
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	NAS	10692450
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	ISS
GO:0051209	Process	Release of sequestered calcium ion into cytosol	ISS
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	1672265
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051928	Process	Positive regulation of calcium ion transport	ISS
GO:0060155	Process	Platelet dense granule organization	IC	1672265
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IDA	1672265
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IEA
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IEA
GO:0099553	Process	Trans-synaptic signaling by endocannabinoid, modulating synaptic transmission	IEA
GO:1900134	Process	Negative regulation of renin secretion into blood stream	IEA
GO:1900134	Process	Negative regulation of renin secretion into blood stream	ISS

MIM	HGNC	e!Ensembl
187930	3537	ENSG00000181104

Protein

UniProt ID

P25116

Protein name

Proteinase-activated receptor 1 (PAR-1) (Coagulation factor II receptor) (Thrombin receptor)

Protein function

High affinity receptor that binds the activated thrombin, leading to calcium release from intracellular stores (PubMed:1672265, PubMed:8136362). The thrombin-activated receptor signaling pathway is mediated through PTX-insensitive G proteins, ac

PDB

1NRN , 1NRO , 1NRP , 1NRQ , 1NRR , 3BEF , 3HKI , 3HKJ , 3LU9 , 3VW7 , 8XOR , 8XOS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	119 → 371	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Platelets and vascular endothelial cells.

Sequence

MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT

Sequence length

425

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Calcium signaling pathway cAMP signaling pathway Phospholipase D signaling pathway Neuroactive ligand-receptor interaction PI3K-Akt signaling pathway Complement and coagulation cascades Platelet activation Regulation of actin cytoskeleton Pathogenic Escherichia coli infection Pathways in cancer		Common Pathway of Fibrin Clot Formation Peptide ligand-binding receptors G alpha (q) signalling events Thrombin signalling through proteinase activated receptors (PARs)

F2R (coagulation factor II thrombin receptor)