Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2149
Gene name	Coagulation factor II thrombin receptor
Gene symbol	F2R
Synonyms (NCBI Gene)	CF2RHTRPAR-1PAR1TR
Chromosome	5
Chromosome location	5q13.3
Summary	Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results i

355

Show/Hide all (355)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052570	hsa-let-7a-5p	CLASH	23622248
MIRT037083	hsa-miR-877-3p	CLASH	23622248
MIRT706041	hsa-miR-186-3p	HITS-CLIP	22927820
MIRT706040	hsa-miR-150-5p	HITS-CLIP	22927820
MIRT706039	hsa-miR-3653-5p	HITS-CLIP	22927820
MIRT706038	hsa-miR-1976	HITS-CLIP	22927820
MIRT706037	hsa-miR-6790-3p	HITS-CLIP	22927820
MIRT706036	hsa-miR-6821-3p	HITS-CLIP	22927820
MIRT706035	hsa-miR-6778-3p	HITS-CLIP	22927820
MIRT706034	hsa-miR-1193	HITS-CLIP	22927820
MIRT706033	hsa-miR-378a-5p	HITS-CLIP	22927820
MIRT706032	hsa-miR-640	HITS-CLIP	22927820
MIRT706031	hsa-miR-6843-3p	HITS-CLIP	22927820
MIRT706030	hsa-miR-6848-3p	HITS-CLIP	22927820
MIRT571222	hsa-miR-3609	PAR-CLIP	20371350
MIRT571221	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT216663	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT216664	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT216660	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT216661	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT216667	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT216671	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT216670	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT216662	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT571220	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT216674	hsa-miR-33b-3p	PAR-CLIP	20371350
MIRT216668	hsa-miR-515-3p	PAR-CLIP	20371350
MIRT216669	hsa-miR-519e-3p	PAR-CLIP	20371350
MIRT216681	hsa-miR-3659	PAR-CLIP	20371350
MIRT216686	hsa-miR-4706	PAR-CLIP	20371350
MIRT216687	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT571219	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT216678	hsa-miR-3153	PAR-CLIP	20371350
MIRT216690	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT216692	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT216682	hsa-miR-4466	PAR-CLIP	20371350
MIRT216676	hsa-miR-675-5p	PAR-CLIP	20371350
MIRT706041	hsa-miR-186-3p	HITS-CLIP	22927820
MIRT706040	hsa-miR-150-5p	HITS-CLIP	22927820
MIRT706039	hsa-miR-3653-5p	HITS-CLIP	22927820
MIRT706038	hsa-miR-1976	HITS-CLIP	22927820
MIRT706037	hsa-miR-6790-3p	HITS-CLIP	22927820
MIRT706036	hsa-miR-6821-3p	HITS-CLIP	22927820
MIRT706035	hsa-miR-6778-3p	HITS-CLIP	22927820
MIRT706034	hsa-miR-1193	HITS-CLIP	22927820
MIRT706033	hsa-miR-378a-5p	HITS-CLIP	22927820
MIRT706032	hsa-miR-640	HITS-CLIP	22927820
MIRT706031	hsa-miR-6843-3p	HITS-CLIP	22927820
MIRT706030	hsa-miR-6848-3p	HITS-CLIP	22927820
MIRT571222	hsa-miR-3609	PAR-CLIP	20371350
MIRT571221	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT216663	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT216664	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT216660	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT216661	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT216667	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT216671	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT216670	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT216662	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT571220	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT216674	hsa-miR-33b-3p	PAR-CLIP	20371350
MIRT216668	hsa-miR-515-3p	PAR-CLIP	20371350
MIRT216669	hsa-miR-519e-3p	PAR-CLIP	20371350
MIRT216681	hsa-miR-3659	PAR-CLIP	20371350
MIRT216686	hsa-miR-4706	PAR-CLIP	20371350
MIRT216687	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT571219	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT216678	hsa-miR-3153	PAR-CLIP	20371350
MIRT216690	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT216692	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT216682	hsa-miR-4466	PAR-CLIP	20371350
MIRT216676	hsa-miR-675-5p	PAR-CLIP	20371350
MIRT974316	hsa-miR-106a	CLIP-seq
MIRT974317	hsa-miR-106b	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT974319	hsa-miR-150	CLIP-seq
MIRT974320	hsa-miR-17	CLIP-seq
MIRT974321	hsa-miR-1825	CLIP-seq
MIRT974322	hsa-miR-20a	CLIP-seq
MIRT974323	hsa-miR-20b	CLIP-seq
MIRT974324	hsa-miR-2115	CLIP-seq
MIRT974325	hsa-miR-2392	CLIP-seq
MIRT974326	hsa-miR-302a	CLIP-seq
MIRT974327	hsa-miR-302b	CLIP-seq
MIRT974328	hsa-miR-302c	CLIP-seq
MIRT974329	hsa-miR-302d	CLIP-seq
MIRT974330	hsa-miR-302e	CLIP-seq
MIRT974331	hsa-miR-3074-3p	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT974333	hsa-miR-3152-3p	CLIP-seq
MIRT974334	hsa-miR-3176	CLIP-seq
MIRT974335	hsa-miR-3182	CLIP-seq
MIRT974336	hsa-miR-361-5p	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT974338	hsa-miR-372	CLIP-seq
MIRT974339	hsa-miR-373	CLIP-seq
MIRT974340	hsa-miR-3922-3p	CLIP-seq
MIRT974341	hsa-miR-3942-3p	CLIP-seq
MIRT974342	hsa-miR-4263	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT974345	hsa-miR-4438	CLIP-seq
MIRT974346	hsa-miR-4506	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT974348	hsa-miR-4652-3p	CLIP-seq
MIRT974349	hsa-miR-4659a-3p	CLIP-seq
MIRT974350	hsa-miR-4659b-3p	CLIP-seq
MIRT974351	hsa-miR-4662a-5p	CLIP-seq
MIRT974352	hsa-miR-4676-5p	CLIP-seq
MIRT974353	hsa-miR-4731-5p	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT974355	hsa-miR-5095	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT974357	hsa-miR-512-3p	CLIP-seq
MIRT974358	hsa-miR-516a-3p	CLIP-seq
MIRT974359	hsa-miR-519d	CLIP-seq
MIRT974360	hsa-miR-520a-3p	CLIP-seq
MIRT974361	hsa-miR-520b	CLIP-seq
MIRT974362	hsa-miR-520c-3p	CLIP-seq
MIRT974363	hsa-miR-520d-3p	CLIP-seq
MIRT974364	hsa-miR-520e	CLIP-seq
MIRT974365	hsa-miR-520g	CLIP-seq
MIRT974366	hsa-miR-520h	CLIP-seq
MIRT974367	hsa-miR-548aa	CLIP-seq
MIRT974368	hsa-miR-575	CLIP-seq
MIRT974369	hsa-miR-576-5p	CLIP-seq
MIRT974370	hsa-miR-587	CLIP-seq
MIRT974371	hsa-miR-621	CLIP-seq
MIRT974372	hsa-miR-93	CLIP-seq
MIRT974316	hsa-miR-106a	CLIP-seq
MIRT974317	hsa-miR-106b	CLIP-seq
MIRT1556325	hsa-miR-1284	CLIP-seq
MIRT974320	hsa-miR-17	CLIP-seq
MIRT974322	hsa-miR-20a	CLIP-seq
MIRT974323	hsa-miR-20b	CLIP-seq
MIRT1556326	hsa-miR-217	CLIP-seq
MIRT1556327	hsa-miR-4418	CLIP-seq
MIRT1556328	hsa-miR-4793-3p	CLIP-seq
MIRT1556329	hsa-miR-509-3-5p	CLIP-seq
MIRT1556330	hsa-miR-509-5p	CLIP-seq
MIRT974359	hsa-miR-519d	CLIP-seq
MIRT1556331	hsa-miR-519e	CLIP-seq
MIRT1556332	hsa-miR-548ah	CLIP-seq
MIRT974372	hsa-miR-93	CLIP-seq
MIRT974325	hsa-miR-2392	CLIP-seq
MIRT974333	hsa-miR-3152-3p	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT974351	hsa-miR-4662a-5p	CLIP-seq
MIRT974352	hsa-miR-4676-5p	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT974368	hsa-miR-575	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT1988678	hsa-miR-154	CLIP-seq
MIRT1988679	hsa-miR-23a	CLIP-seq
MIRT1988680	hsa-miR-23b	CLIP-seq
MIRT1988681	hsa-miR-23c	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT1988682	hsa-miR-3199	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT1988683	hsa-miR-450b-5p	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT1988684	hsa-miR-4715-3p	CLIP-seq
MIRT1988685	hsa-miR-4722-3p	CLIP-seq
MIRT1988686	hsa-miR-4729	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT1988688	hsa-miR-4740-3p	CLIP-seq
MIRT1988689	hsa-miR-4763-5p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT1988691	hsa-miR-507	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT1988692	hsa-miR-550a	CLIP-seq
MIRT1988693	hsa-miR-552	CLIP-seq
MIRT1988694	hsa-miR-557	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT1988696	hsa-miR-764	CLIP-seq
MIRT2223102	hsa-miR-1267	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT2223103	hsa-miR-1281	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT2223104	hsa-miR-1307	CLIP-seq
MIRT2223105	hsa-miR-1343	CLIP-seq
MIRT974325	hsa-miR-2392	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT1988682	hsa-miR-3199	CLIP-seq
MIRT2223106	hsa-miR-338-5p	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT2223107	hsa-miR-4284	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT2223108	hsa-miR-4534	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT2223109	hsa-miR-4638-5p	CLIP-seq
MIRT1988685	hsa-miR-4722-3p	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT1988688	hsa-miR-4740-3p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT2223110	hsa-miR-4803	CLIP-seq
MIRT2223111	hsa-miR-548ac	CLIP-seq
MIRT2223112	hsa-miR-548ae	CLIP-seq
MIRT2223113	hsa-miR-548aj	CLIP-seq
MIRT2223114	hsa-miR-548am	CLIP-seq
MIRT2223115	hsa-miR-548d-3p	CLIP-seq
MIRT2223116	hsa-miR-548x	CLIP-seq
MIRT2223117	hsa-miR-548z	CLIP-seq
MIRT1988693	hsa-miR-552	CLIP-seq
MIRT2223118	hsa-miR-582-5p	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT2223119	hsa-miR-624	CLIP-seq
MIRT974316	hsa-miR-106a	CLIP-seq
MIRT974317	hsa-miR-106b	CLIP-seq
MIRT2526986	hsa-miR-1245b-5p	CLIP-seq
MIRT2526987	hsa-miR-1248	CLIP-seq
MIRT2526988	hsa-miR-1254	CLIP-seq
MIRT2526989	hsa-miR-1266	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT2526990	hsa-miR-1289	CLIP-seq
MIRT2526991	hsa-miR-1291	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT2526992	hsa-miR-1301	CLIP-seq
MIRT2526993	hsa-miR-147	CLIP-seq
MIRT974319	hsa-miR-150	CLIP-seq
MIRT974320	hsa-miR-17	CLIP-seq
MIRT974322	hsa-miR-20a	CLIP-seq
MIRT974323	hsa-miR-20b	CLIP-seq
MIRT2526994	hsa-miR-28-3p	CLIP-seq
MIRT974326	hsa-miR-302a	CLIP-seq
MIRT974327	hsa-miR-302b	CLIP-seq
MIRT974328	hsa-miR-302c	CLIP-seq
MIRT974329	hsa-miR-302d	CLIP-seq
MIRT974330	hsa-miR-302e	CLIP-seq
MIRT2526995	hsa-miR-3116	CLIP-seq
MIRT2526996	hsa-miR-3130-5p	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT2526997	hsa-miR-3140-3p	CLIP-seq
MIRT2526998	hsa-miR-3142	CLIP-seq
MIRT2526999	hsa-miR-3180	CLIP-seq
MIRT2527000	hsa-miR-3180-3p	CLIP-seq
MIRT2527001	hsa-miR-3196	CLIP-seq
MIRT2527002	hsa-miR-3198	CLIP-seq
MIRT2527003	hsa-miR-328	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT2527004	hsa-miR-346	CLIP-seq
MIRT2527005	hsa-miR-3622b-5p	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT2527006	hsa-miR-3664-3p	CLIP-seq
MIRT2527007	hsa-miR-3664-5p	CLIP-seq
MIRT2527008	hsa-miR-3681	CLIP-seq
MIRT2527009	hsa-miR-3691-5p	CLIP-seq
MIRT974338	hsa-miR-372	CLIP-seq
MIRT974339	hsa-miR-373	CLIP-seq
MIRT974341	hsa-miR-3942-3p	CLIP-seq
MIRT2527010	hsa-miR-3945	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT2527011	hsa-miR-4253	CLIP-seq
MIRT2527012	hsa-miR-4254	CLIP-seq
MIRT2527013	hsa-miR-4266	CLIP-seq
MIRT2527014	hsa-miR-4288	CLIP-seq
MIRT2527015	hsa-miR-4294	CLIP-seq
MIRT2527016	hsa-miR-4297	CLIP-seq
MIRT2527017	hsa-miR-4309	CLIP-seq
MIRT2527018	hsa-miR-4312	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT2527019	hsa-miR-4482	CLIP-seq
MIRT2527020	hsa-miR-4488	CLIP-seq
MIRT1988683	hsa-miR-450b-5p	CLIP-seq
MIRT2527021	hsa-miR-4518	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT2527022	hsa-miR-4643	CLIP-seq
MIRT2527023	hsa-miR-4650-5p	CLIP-seq
MIRT2527024	hsa-miR-4660	CLIP-seq
MIRT2527025	hsa-miR-4691-5p	CLIP-seq
MIRT2527026	hsa-miR-4695-5p	CLIP-seq
MIRT2527027	hsa-miR-4697-5p	CLIP-seq
MIRT2527028	hsa-miR-4711-3p	CLIP-seq
MIRT2527029	hsa-miR-4714-5p	CLIP-seq
MIRT1988684	hsa-miR-4715-3p	CLIP-seq
MIRT2527030	hsa-miR-4720-5p	CLIP-seq
MIRT974353	hsa-miR-4731-5p	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT2527031	hsa-miR-4766-5p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT2527032	hsa-miR-4779	CLIP-seq
MIRT2527033	hsa-miR-4787-5p	CLIP-seq
MIRT2527034	hsa-miR-4799-3p	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT2527035	hsa-miR-494	CLIP-seq
MIRT2527036	hsa-miR-5047	CLIP-seq
MIRT1988691	hsa-miR-507	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT974357	hsa-miR-512-3p	CLIP-seq
MIRT974359	hsa-miR-519d	CLIP-seq
MIRT974360	hsa-miR-520a-3p	CLIP-seq
MIRT974361	hsa-miR-520b	CLIP-seq
MIRT974362	hsa-miR-520c-3p	CLIP-seq
MIRT974363	hsa-miR-520d-3p	CLIP-seq
MIRT974364	hsa-miR-520e	CLIP-seq
MIRT974365	hsa-miR-520g	CLIP-seq
MIRT974366	hsa-miR-520h	CLIP-seq
MIRT2527037	hsa-miR-532-5p	CLIP-seq
MIRT1988694	hsa-miR-557	CLIP-seq
MIRT2527038	hsa-miR-576-3p	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT2527039	hsa-miR-599	CLIP-seq
MIRT2527040	hsa-miR-606	CLIP-seq
MIRT2527041	hsa-miR-632	CLIP-seq
MIRT2527042	hsa-miR-642b	CLIP-seq
MIRT2527043	hsa-miR-661	CLIP-seq
MIRT2527044	hsa-miR-873	CLIP-seq
MIRT974372	hsa-miR-93	CLIP-seq
MIRT2526988	hsa-miR-1254	CLIP-seq
MIRT2526990	hsa-miR-1289	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT2526994	hsa-miR-28-3p	CLIP-seq
MIRT2526995	hsa-miR-3116	CLIP-seq
MIRT2526996	hsa-miR-3130-5p	CLIP-seq
MIRT2527002	hsa-miR-3198	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT2527004	hsa-miR-346	CLIP-seq
MIRT2527008	hsa-miR-3681	CLIP-seq
MIRT2527009	hsa-miR-3691-5p	CLIP-seq
MIRT974341	hsa-miR-3942-3p	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT2527012	hsa-miR-4254	CLIP-seq
MIRT2527014	hsa-miR-4288	CLIP-seq
MIRT2527015	hsa-miR-4294	CLIP-seq
MIRT2527017	hsa-miR-4309	CLIP-seq
MIRT2527019	hsa-miR-4482	CLIP-seq
MIRT1988683	hsa-miR-450b-5p	CLIP-seq
MIRT2527025	hsa-miR-4691-5p	CLIP-seq
MIRT2527028	hsa-miR-4711-3p	CLIP-seq
MIRT1988684	hsa-miR-4715-3p	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT1988691	hsa-miR-507	CLIP-seq
MIRT1988694	hsa-miR-557	CLIP-seq
MIRT2527038	hsa-miR-576-3p	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT2527040	hsa-miR-606	CLIP-seq
MIRT2527041	hsa-miR-632	CLIP-seq
MIRT2527043	hsa-miR-661	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
SP1	Unknown	9494121
SP3	Unknown	9494121
STAT3	Activation	23504318
TFAP2A	Unknown	20805990
TWIST1	Repression	19051271
TWIST2	Repression	19051271

Show/Hide all (94)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0001965	Function	G-protein alpha-subunit binding	ISS
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	IDA	9639571
GO:0003105	Process	Negative regulation of glomerular filtration	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	ISS
GO:0004930	Function	G protein-coupled receptor activity	TAS	17848177
GO:0005102	Function	Signaling receptor binding	IPI	1672265
GO:0005515	Function	Protein binding	IPI	17299037, 17848177, 20164183, 20826780, 22547407, 24732013
GO:0005576	Component	Extracellular region	TAS
GO:0005769	Component	Early endosome	IDA	22547407, 24732013
GO:0005770	Component	Late endosome	IDA	24732013
GO:0005794	Component	Golgi apparatus	TAS	7961693
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9038223, 22547407
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	1672265
GO:0005901	Component	Caveola	IDA	17848177
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	20164183
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007529	Process	Establishment of synaptic specificity at neuromuscular junction	ISS
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10692450
GO:0009611	Process	Response to wounding	IDA	9639571
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9701242
GO:0009986	Component	Cell surface	IDA	24732013
GO:0014047	Process	Glutamate secretion	ISS
GO:0015057	Function	Thrombin-activated receptor activity	IBA
GO:0015057	Function	Thrombin-activated receptor activity	IDA	1672265, 10692450
GO:0015057	Function	Thrombin-activated receptor activity	IEA
GO:0015057	Function	Thrombin-activated receptor activity	TAS	9038223
GO:0016020	Component	Membrane	IEA
GO:0030168	Process	Platelet activation	IDA	9038223
GO:0030193	Process	Regulation of blood coagulation	IDA	17848177
GO:0030194	Process	Positive regulation of blood coagulation	IBA
GO:0030194	Process	Positive regulation of blood coagulation	IDA	9038223
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	9701242
GO:0031094	Component	Platelet dense tubular network	IDA	9038223
GO:0031594	Component	Neuromuscular junction	ISS
GO:0031681	Function	G-protein beta-subunit binding	IEA
GO:0031681	Function	G-protein beta-subunit binding	ISS
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032651	Process	Regulation of interleukin-1 beta production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	11447194
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	17404307
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	9639571
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IEA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	ISS
GO:0036145	Process	Dendritic cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	10692450
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	17848177
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0045211	Component	Postsynaptic membrane	ISS
GO:0045217	Process	Cell-cell junction maintenance	IMP	23202369
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	17848177
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	ISS
GO:0045987	Process	Positive regulation of smooth muscle contraction	ISS
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	NAS	10692450
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	ISS
GO:0051209	Process	Release of sequestered calcium ion into cytosol	ISS
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	1672265
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051928	Process	Positive regulation of calcium ion transport	ISS
GO:0060155	Process	Platelet dense granule organization	IC	1672265
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IDA	1672265
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IEA
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IEA
GO:0099553	Process	Trans-synaptic signaling by endocannabinoid, modulating synaptic transmission	IEA
GO:1900134	Process	Negative regulation of renin secretion into blood stream	IEA
GO:1900134	Process	Negative regulation of renin secretion into blood stream	ISS

MIM	HGNC	e!Ensembl
187930	3537	ENSG00000181104

P25116

Protein name

Proteinase-activated receptor 1 (PAR-1) (Coagulation factor II receptor) (Thrombin receptor)

Protein function

High affinity receptor that binds the activated thrombin, leading to calcium release from intracellular stores (PubMed:1672265, PubMed:8136362). The thrombin-activated receptor signaling pathway is mediated through PTX-insensitive G proteins, ac

PDB

1NRN , 1NRO , 1NRP , 1NRQ , 1NRR , 3BEF , 3HKI , 3HKJ , 3LU9 , 3VW7 , 8XOR , 8XOS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	119 → 371	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Platelets and vascular endothelial cells.

Sequence

MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT

Sequence length

425

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Calcium signaling pathway cAMP signaling pathway Phospholipase D signaling pathway Neuroactive ligand-receptor interaction PI3K-Akt signaling pathway Complement and coagulation cascades Platelet activation Regulation of actin cytoskeleton Pathogenic Escherichia coli infection Pathways in cancer		Common Pathway of Fibrin Clot Formation Peptide ligand-binding receptors G alpha (q) signalling events Thrombin signalling through proteinase activated receptors (PARs)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
F2R-related disorder	Benign	rs2227745	RCV003922149

Show/Hide Text Mining Associations (155)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Coronary Syndrome	Associate	22459907
Adenocarcinoma	Associate	33932087
Adenocarcinoma of Lung	Associate	12548614, 20445954
Anemia Hemolytic	Associate	6302135
Anemia Refractory	Associate	8395910
Arthritis Rheumatoid	Associate	18787303
Atherosclerosis	Associate	12805069, 23740526, 35742805, 36430902
Atrial Fibrillation	Associate	28747025
Autism Spectrum Disorder	Associate	33442040
Blood Coagulation Disorders	Associate	24973402, 26278396, 30891029, 34235728
Blood Platelet Disorders	Associate	16194864, 22212092, 22459907, 26556638, 28747025, 35054966
Blood Platelet Disorders	Stimulate	24156029
Brain Ischemia	Associate	25901734
Brain Neoplasms	Associate	19622587
Breast Neoplasms	Associate	11278329, 14966279, 17470200, 26165842, 26244666, 26392299, 29348172
Bronchiolitis Obliterans Syndrome	Associate	37965310
Calcinosis Cutis	Associate	19703903, 26165842
Carcinogenesis	Associate	20056842, 21622534, 22086466, 37486532
Carcinoma Hepatocellular	Associate	16434963, 19749797, 20146079, 21622534, 21909684, 29195126
Carcinoma Hepatocellular	Inhibit	26968954
Carcinoma Intraductal Noninfiltrating	Stimulate	31962001
Carcinoma Non Small Cell Lung	Associate	28173772, 36833388
Carcinoma Ovarian Epithelial	Associate	28148395
Carcinoma Pancreatic Ductal	Associate	33932087
Carcinoma Renal Cell	Associate	19407221, 21622534
Cardiomyopathy Dilated	Stimulate	16202218
Cardiovascular Diseases	Associate	26278396
Chronic Disease	Associate	24612435
Chronic Kidney Disease Mineral and Bone Disorder	Associate	28784837
Colonic Neoplasms	Associate	12707033, 17164780
Colorectal Neoplasms	Associate	12707033, 20056842, 21907696, 24284797, 25119598, 25846512
Corneal Endothelial Cell Loss	Associate	24624928
Coronary Artery Disease	Associate	16194864
COVID 19	Associate	34235728
Crohn Disease	Associate	18832729
Cytokine Release Syndrome	Associate	34235728
Cytomegalovirus Infections	Associate	20034645
Death	Associate	23293110, 27761580
Diabetes Mellitus	Associate	23740526
Diabetic Nephropathies	Associate	37415174
Disease	Associate	19809478
Drug Hypersensitivity	Associate	35708029
Drug Related Side Effects and Adverse Reactions	Associate	28655310
Endocrine System Diseases	Associate	21622534
Esophageal Neoplasms	Stimulate	25297082
Esophageal Squamous Cell Carcinoma	Associate	22086466
Esophageal Squamous Cell Carcinoma	Stimulate	25297082
Fibrosis	Associate	15563688
Fractures Spontaneous	Associate	9815150
Friedreich Ataxia	Associate	24737321
Glioblastoma	Associate	20462964, 22497886
Glioma	Stimulate	32507767
Graves Disease	Stimulate	16285898
Gray Platelet Syndrome	Associate	25806575
Hemangioma Cavernous Central Nervous System	Associate	37030452
Hemorrhage	Associate	24612435, 30055940
Hemorrhagic Stroke	Associate	35302736
Hepatitis B	Associate	8638607
HIV Infections	Stimulate	27703039
Hodgkin Disease	Associate	37552109, 6302135
Hyperkinesis	Associate	22228373
Hyperlipidemias	Associate	37947652
Hypoglycemia	Associate	9721728
Hypothyroidism	Associate	37947652
Hypoxia	Associate	35853902
Immunologic Deficiency Syndromes	Associate	24737321
Infertility Male	Associate	25539146
Inflammation	Associate	16951492, 19703903, 24284797, 24453410, 24624928, 24973402, 26278396, 31230554, 34373558, 35742805
Inflammatory Breast Neoplasms	Associate	23280128
Insulinoma	Associate	29851790
Intestinal Diseases	Associate	11447011
Invasive Pulmonary Aspergillosis	Associate	22971327
Kidney Diseases	Associate	34115025, 37965310
LEOPARD Syndrome	Stimulate	16202218
Leprosy	Associate	26367014
Leukemia	Associate	21216163, 30076949
Leukemia Lymphocytic Chronic B Cell	Associate	35149845
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	21216163, 30076949
Leukemia Myeloid Acute	Stimulate	21216163
Leukemia Myeloid Acute	Associate	27258612
Livedoid Vasculopathy	Associate	37965310
Lung Diseases	Associate	15563688
Lung Neoplasms	Associate	25861627, 27566553, 28173772
Lymphatic Metastasis	Associate	18507028, 39363900
Lymphatic Metastasis	Stimulate	22086466
Lymphoma	Associate	31227779, 31243313, 33686511
Lymphoma Primary Effusion	Associate	32975904
Lymphoma T Cell	Associate	37552109, 8638607
Medulloblastoma	Associate	25163932
Melanoma	Stimulate	12975361, 21993564
Melanoma	Associate	16946713, 19679555, 19703903, 34373558
Meningioma	Associate	12926518
Mental Disorders	Associate	33442040
Mesothelioma	Associate	25364818
Mesothelioma Malignant	Associate	25364818
Microphthalmia Syndromic 10	Associate	28655310
Mitochondrial Diseases	Associate	19809478
Multiple Myeloma	Associate	11468178
Multiple Sclerosis	Associate	28655310, 33086557, 34207429
Myelodysplastic Syndromes	Associate	34343137
Myocardial Ischemia	Associate	37940228
Neoplasm Metastasis	Associate	11278329, 11395381, 12975361, 19679555, 19703903, 21216163, 21993564, 23921961, 28173772, 32536459, 34373558
Neoplasm Metastasis	Stimulate	19170048, 31962001, 32507767
Neoplasm Residual	Associate	34337744, 35622320
Neoplasms	Associate	11278329, 11395381, 12548614, 12857925, 12975361, 15498875, 16434963, 18507028, 19622587, 19749797, 20056842, 20445954, 20723226, 21216163, 21753781 View all (21 more)
Neoplasms	Stimulate	24817013, 25163932, 27566553, 32507767
Neoplasms	Inhibit	26968954
Neurotoxicity Syndromes	Associate	28655310
Oropharyngeal Neoplasms	Associate	37486532
Osteosarcoma	Associate	18048360
Pancreatic Neoplasms	Associate	23293110, 23555989, 24699825, 33932087
Pancreatitis Chronic	Associate	23555989
Papillomavirus Infections	Associate	37486532
Peripheral Arterial Disease	Stimulate	23740526
Peripheral Arterial Disease	Associate	24913105
Peritonitis	Associate	18507028, 6302135
Plaque Atherosclerotic	Associate	35742805
Polycystic Ovary Syndrome	Associate	32323770
Pre Eclampsia	Associate	35035521
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Stimulate	21216163
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	24885090, 35622320
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	31243313
Preeclamptic toxemia	Associate	21224082
Prostatic Neoplasms	Associate	16052512, 17492768, 19170048, 28510269
Proteinuria	Associate	23024298
Pulmonary Disease Chronic Obstructive	Associate	12645829, 24973402, 26278396, 26535635
Pulmonary Embolism	Associate	24337368
Pulmonary Fibrosis	Associate	25539146, 25612863
Renal Insufficiency Chronic	Associate	24913105
Retinitis Pigmentosa	Associate	35410372
Sarcoidosis	Associate	26278396
Skin Diseases	Associate	23675494
Skin Neoplasms	Associate	21993564, 23675494
Soft Tissue Injuries	Associate	27566553
Squamous Cell Carcinoma of Head and Neck	Associate	32536459
ST Elevation Myocardial Infarction	Associate	25901734
Status Asthmaticus	Associate	22281988
Stevens Johnson Syndrome	Associate	37947652
Stomach Neoplasms	Associate	16367923, 18507028, 19622587, 20723226, 24817013, 36438913, 38291086
Syndrome	Associate	8395910
Tertiary Lymphoid Structures	Associate	22086466
Thromboembolism	Associate	16194864, 33086557
Thrombosis	Associate	25934730, 32507767, 33086557, 8395910
Thyroid Cancer Papillary	Associate	39363900
Thyroid Hormone Resistance Syndrome	Associate	19299458, 25867808, 36191835, 7913468, 9804773
Thyroiditis Autoimmune	Stimulate	34115025
Trauma Nervous System	Associate	30450637
Triple Negative Breast Neoplasms	Associate	32034579
Urinary Bladder Neoplasms	Associate	33558481
Uterine Cervical Neoplasms	Associate	37486532
Vascular Diseases	Associate	31230554, 34873055
Vascular System Injuries	Associate	16606835, 17170365
Venous Thromboembolism	Inhibit	19552680
Venous Thromboembolism	Associate	19552680, 27761580
X Linked Combined Immunodeficiency Diseases	Associate	19809478

F2R (coagulation factor II thrombin receptor)