Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2147
Gene name Gene Name - the full gene name approved by the HGNC.	Coagulation factor II, thrombin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	F2
Synonyms (NCBI Gene) Gene synonyms aliases	PT, RPRGL2, THPH1
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the prothrombin protein (also known as coagulation factor II). This protein is proteolytically cleaved in multiple steps to form the activated serine protease thrombin. The activated thrombin enzyme plays an important role in thrombosis

Show/Hide all(19)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1799963	G>A	Pathogenic, risk-factor	Downstream transcript variant, genic downstream transcript variant, 3 prime UTR variant
rs62623459	G>A	Pathogenic, uncertain-significance	Coding sequence variant, missense variant, non coding transcript variant
rs121918477	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs121918478	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs121918479	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs121918480	G>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs121918481	T>C	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs121918482	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs121918483	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs121918484	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs121918485	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs121918486	C>G	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs387906522	->T	Pathogenic	Stop gained, coding sequence variant, non coding transcript variant
rs387907201	G>A,T	Pathogenic, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, non coding transcript variant
rs754231232	G>A	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs767702854	AAG>-	Likely-pathogenic	Coding sequence variant, non coding transcript variant, inframe deletion
rs776618390	AT>-	Uncertain-significance, likely-pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1227147475	A>G	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1592422740	T>C	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant

Show/Hide all(207)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001484	hsa-miR-16-5p	pSILAC	18668040
MIRT021414	hsa-miR-9-5p	Microarray	17612493
MIRT001360	hsa-miR-1-3p	Proteomics	18668040
MIRT001484	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT001622	hsa-let-7b-5p	Proteomics	18668040
MIRT551436	hsa-miR-1306-5p	HITS-CLIP	21572407
MIRT517922	hsa-miR-1224-3p	HITS-CLIP	21572407
MIRT517921	hsa-miR-4740-3p	HITS-CLIP	21572407
MIRT551435	hsa-miR-660-3p	HITS-CLIP	21572407
MIRT551434	hsa-miR-939-3p	HITS-CLIP	21572407
MIRT551433	hsa-miR-6852-5p	HITS-CLIP	21572407
MIRT551432	hsa-miR-6742-3p	HITS-CLIP	21572407
MIRT517920	hsa-miR-532-3p	HITS-CLIP	21572407
MIRT551431	hsa-miR-378g	HITS-CLIP	21572407
MIRT517919	hsa-miR-6778-3p	HITS-CLIP	21572407
MIRT517918	hsa-miR-423-3p	HITS-CLIP	21572407
MIRT517917	hsa-miR-4437	HITS-CLIP	21572407
MIRT517916	hsa-miR-1260a	HITS-CLIP	21572407
MIRT517915	hsa-miR-1260b	HITS-CLIP	21572407
MIRT517914	hsa-miR-6749-3p	HITS-CLIP	21572407
MIRT551430	hsa-miR-1343-3p	HITS-CLIP	21572407
MIRT551429	hsa-miR-6783-3p	HITS-CLIP	21572407
MIRT517913	hsa-miR-4674	HITS-CLIP	21572407
MIRT673592	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT672199	hsa-miR-3655	HITS-CLIP	23824327
MIRT673591	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT672198	hsa-miR-3135b	HITS-CLIP	23824327
MIRT672197	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT672196	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT672195	hsa-miR-3652	HITS-CLIP	23824327
MIRT672194	hsa-miR-4430	HITS-CLIP	23824327
MIRT673590	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT672192	hsa-miR-5698	HITS-CLIP	23824327
MIRT673593	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT673592	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT672199	hsa-miR-3655	HITS-CLIP	23824327
MIRT673591	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT672198	hsa-miR-3135b	HITS-CLIP	23824327
MIRT672197	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT672196	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT672195	hsa-miR-3652	HITS-CLIP	23824327
MIRT672194	hsa-miR-4430	HITS-CLIP	23824327
MIRT673590	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT672192	hsa-miR-5698	HITS-CLIP	23824327
MIRT672199	hsa-miR-3655	HITS-CLIP	23824327
MIRT672198	hsa-miR-3135b	HITS-CLIP	23824327
MIRT672197	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT672196	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT672195	hsa-miR-3652	HITS-CLIP	23824327
MIRT672194	hsa-miR-4430	HITS-CLIP	23824327
MIRT672193	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT672192	hsa-miR-5698	HITS-CLIP	23824327
MIRT647952	hsa-miR-34b-3p	HITS-CLIP	23824327
MIRT647950	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT647951	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT633778	hsa-miR-662	HITS-CLIP	23824327
MIRT633777	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT517920	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT633776	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT633775	hsa-miR-1976	HITS-CLIP	23824327
MIRT517919	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT633774	hsa-miR-1206	HITS-CLIP	23824327
MIRT633773	hsa-miR-4279	HITS-CLIP	23824327
MIRT633772	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT551436	hsa-miR-1306-5p	PAR-CLIP	21572407
MIRT517922	hsa-miR-1224-3p	PAR-CLIP	21572407
MIRT517921	hsa-miR-4740-3p	PAR-CLIP	21572407
MIRT551435	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT551434	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT551433	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT551432	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT517920	hsa-miR-532-3p	PAR-CLIP	21572407
MIRT551431	hsa-miR-378g	PAR-CLIP	21572407
MIRT517919	hsa-miR-6778-3p	PAR-CLIP	21572407
MIRT517917	hsa-miR-4437	PAR-CLIP	21572407
MIRT517916	hsa-miR-1260a	PAR-CLIP	21572407
MIRT517915	hsa-miR-1260b	PAR-CLIP	21572407
MIRT517914	hsa-miR-6749-3p	PAR-CLIP	21572407
MIRT551430	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT551429	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT517913	hsa-miR-4674	PAR-CLIP	21572407
MIRT517922	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT517921	hsa-miR-4740-3p	PAR-CLIP	23446348
MIRT517920	hsa-miR-532-3p	PAR-CLIP	23446348
MIRT517919	hsa-miR-6778-3p	PAR-CLIP	23446348
MIRT517918	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT517917	hsa-miR-4437	PAR-CLIP	23446348
MIRT517916	hsa-miR-1260a	PAR-CLIP	23446348
MIRT517915	hsa-miR-1260b	PAR-CLIP	23446348
MIRT517914	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT517913	hsa-miR-4674	PAR-CLIP	23446348
MIRT517922	hsa-miR-1224-3p	PAR-CLIP	27292025
MIRT517922	hsa-miR-1224-3p	PAR-CLIP	27292025
MIRT517916	hsa-miR-1260a	PAR-CLIP	27292025
MIRT517916	hsa-miR-1260a	PAR-CLIP	27292025
MIRT517915	hsa-miR-1260b	PAR-CLIP	27292025
MIRT517915	hsa-miR-1260b	PAR-CLIP	27292025
MIRT551436	hsa-miR-1306-5p	PAR-CLIP	27292025
MIRT551430	hsa-miR-1343-3p	PAR-CLIP	27292025
MIRT647952	hsa-miR-34b-3p	PAR-CLIP	27292025
MIRT647950	hsa-miR-3614-5p	PAR-CLIP	27292025
MIRT551431	hsa-miR-378g	PAR-CLIP	27292025
MIRT551431	hsa-miR-378g	PAR-CLIP	27292025
MIRT517917	hsa-miR-4437	PAR-CLIP	27292025
MIRT517917	hsa-miR-4437	PAR-CLIP	27292025
MIRT517913	hsa-miR-4674	PAR-CLIP	27292025
MIRT517913	hsa-miR-4674	PAR-CLIP	27292025
MIRT517921	hsa-miR-4740-3p	PAR-CLIP	27292025
MIRT517921	hsa-miR-4740-3p	PAR-CLIP	27292025
MIRT647951	hsa-miR-6500-3p	PAR-CLIP	27292025
MIRT551435	hsa-miR-660-3p	PAR-CLIP	27292025
MIRT551432	hsa-miR-6742-3p	PAR-CLIP	27292025
MIRT517914	hsa-miR-6749-3p	PAR-CLIP	27292025
MIRT517914	hsa-miR-6749-3p	PAR-CLIP	27292025
MIRT517919	hsa-miR-6778-3p	PAR-CLIP	27292025
MIRT517919	hsa-miR-6778-3p	PAR-CLIP	27292025
MIRT551429	hsa-miR-6783-3p	PAR-CLIP	27292025
MIRT551433	hsa-miR-6852-5p	PAR-CLIP	27292025
MIRT551434	hsa-miR-939-3p	PAR-CLIP	27292025
MIRT551434	hsa-miR-939-3p	PAR-CLIP	27292025
MIRT735392	hsa-miR-409-3p	qRT-PCR	32246041
MIRT551436	hsa-miR-1306-5p	HITS-CLIP	21572407
MIRT517922	hsa-miR-1224-3p	HITS-CLIP	21572407
MIRT517921	hsa-miR-4740-3p	HITS-CLIP	21572407
MIRT551435	hsa-miR-660-3p	HITS-CLIP	21572407
MIRT551434	hsa-miR-939-3p	HITS-CLIP	21572407
MIRT551433	hsa-miR-6852-5p	HITS-CLIP	21572407
MIRT551432	hsa-miR-6742-3p	HITS-CLIP	21572407
MIRT517920	hsa-miR-532-3p	HITS-CLIP	21572407
MIRT551431	hsa-miR-378g	HITS-CLIP	21572407
MIRT517919	hsa-miR-6778-3p	HITS-CLIP	21572407
MIRT517918	hsa-miR-423-3p	HITS-CLIP	21572407
MIRT517917	hsa-miR-4437	HITS-CLIP	21572407
MIRT517916	hsa-miR-1260a	HITS-CLIP	21572407
MIRT517915	hsa-miR-1260b	HITS-CLIP	21572407
MIRT517914	hsa-miR-6749-3p	HITS-CLIP	21572407
MIRT551430	hsa-miR-1343-3p	HITS-CLIP	21572407
MIRT551429	hsa-miR-6783-3p	HITS-CLIP	21572407
MIRT517913	hsa-miR-4674	HITS-CLIP	21572407
MIRT673592	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT672199	hsa-miR-3655	HITS-CLIP	23824327
MIRT673591	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT672198	hsa-miR-3135b	HITS-CLIP	23824327
MIRT672197	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT672196	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT672195	hsa-miR-3652	HITS-CLIP	23824327
MIRT672194	hsa-miR-4430	HITS-CLIP	23824327
MIRT673590	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT672192	hsa-miR-5698	HITS-CLIP	23824327
MIRT673593	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT673592	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT672199	hsa-miR-3655	HITS-CLIP	23824327
MIRT673591	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT672198	hsa-miR-3135b	HITS-CLIP	23824327
MIRT672197	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT672196	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT672195	hsa-miR-3652	HITS-CLIP	23824327
MIRT672194	hsa-miR-4430	HITS-CLIP	23824327
MIRT673590	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT672192	hsa-miR-5698	HITS-CLIP	23824327
MIRT672199	hsa-miR-3655	HITS-CLIP	23824327
MIRT672198	hsa-miR-3135b	HITS-CLIP	23824327
MIRT672197	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT672196	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT672195	hsa-miR-3652	HITS-CLIP	23824327
MIRT672194	hsa-miR-4430	HITS-CLIP	23824327
MIRT672193	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT672192	hsa-miR-5698	HITS-CLIP	23824327
MIRT647952	hsa-miR-34b-3p	HITS-CLIP	23824327
MIRT647950	hsa-miR-3614-5p	HITS-CLIP	23824327
MIRT647951	hsa-miR-6500-3p	HITS-CLIP	23824327
MIRT633778	hsa-miR-662	HITS-CLIP	23824327
MIRT633777	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT517920	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT633776	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT633775	hsa-miR-1976	HITS-CLIP	23824327
MIRT517919	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT633774	hsa-miR-1206	HITS-CLIP	23824327
MIRT633773	hsa-miR-4279	HITS-CLIP	23824327
MIRT633772	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT551436	hsa-miR-1306-5p	PAR-CLIP	21572407
MIRT517922	hsa-miR-1224-3p	PAR-CLIP	21572407
MIRT517921	hsa-miR-4740-3p	PAR-CLIP	21572407
MIRT551435	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT551434	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT551433	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT551432	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT517920	hsa-miR-532-3p	PAR-CLIP	21572407
MIRT551431	hsa-miR-378g	PAR-CLIP	21572407
MIRT517919	hsa-miR-6778-3p	PAR-CLIP	21572407
MIRT517917	hsa-miR-4437	PAR-CLIP	21572407
MIRT517916	hsa-miR-1260a	PAR-CLIP	21572407
MIRT517915	hsa-miR-1260b	PAR-CLIP	21572407
MIRT517914	hsa-miR-6749-3p	PAR-CLIP	21572407
MIRT551430	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT551429	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT517913	hsa-miR-4674	PAR-CLIP	21572407
MIRT517922	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT517921	hsa-miR-4740-3p	PAR-CLIP	23446348
MIRT517920	hsa-miR-532-3p	PAR-CLIP	23446348
MIRT517919	hsa-miR-6778-3p	PAR-CLIP	23446348
MIRT517918	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT517917	hsa-miR-4437	PAR-CLIP	23446348
MIRT517916	hsa-miR-1260a	PAR-CLIP	23446348
MIRT517915	hsa-miR-1260b	PAR-CLIP	23446348
MIRT517914	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT517913	hsa-miR-4674	PAR-CLIP	23446348

Show/Hide all(72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IDA	20421939
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	1672265, 12855810
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005102	Function	Signaling receptor binding	IPI	8626514, 12855810
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	2013320, 3279057, 6323392, 8530382, 8626514, 9183005, 14691232, 16230339, 16230340, 28743742, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9639571, 20421939
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	7507931
GO:0006953	Process	Acute-phase response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	1672265
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0007596	Process	Blood coagulation	TAS	7592664
GO:0007599	Process	Hemostasis	IEA
GO:0008083	Function	Growth factor activity	TAS	8626514
GO:0008201	Function	Heparin binding	IDA	20421939
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0009611	Process	Response to wounding	IDA	9639571
GO:0009897	Component	External side of plasma membrane	IDA	20421939
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010544	Process	Negative regulation of platelet activation	TAS	17379830
GO:0016787	Function	Hydrolase activity	IEA
GO:0030168	Process	Platelet activation	IBA
GO:0030168	Process	Platelet activation	IDA	9038223
GO:0030168	Process	Platelet activation	IEA
GO:0030193	Process	Regulation of blood coagulation	TAS	12855810
GO:0030194	Process	Positive regulation of blood coagulation	IBA
GO:0030194	Process	Positive regulation of blood coagulation	IDA	9038223
GO:0030195	Process	Negative regulation of blood coagulation	IDA	10761923
GO:0030195	Process	Negative regulation of blood coagulation	IDA	10761923
GO:0030195	Process	Negative regulation of blood coagulation	TAS	15005336
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	IBA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	9639571
GO:0042730	Process	Fibrinolysis	IDA	12855810
GO:0045861	Process	Negative regulation of proteolysis	IDA	1695900
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	NAS	10692450
GO:0048018	Function	Receptor ligand activity	IDA	10761923
GO:0048712	Process	Negative regulation of astrocyte differentiation	IDA	1691280
GO:0050878	Process	Regulation of body fluid levels	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	1672265, 19052258
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IDA	19052258
GO:0051838	Process	Cytolysis by host of symbiont cells	IDA	20421939
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051918	Process	Negative regulation of fibrinolysis	TAS	17379830
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	20421939
GO:0070053	Function	Thrombospondin receptor activity	IDA	2435757
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IDA	7559487, 11309392
GO:0070945	Process	Neutrophil-mediated killing of gram-negative bacterium	IDA	20421939
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	20421939
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	11309392
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	20164183
GO:1990806	Process	Ligand-gated ion channel signaling pathway	IEA
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	17275676

MIM	HGNC	e!Ensembl
176930	3535	ENSG00000180210

Protein

UniProt ID

P00734

Protein name

Prothrombin (EC 3.4.21.5) (Coagulation factor II) [Cleaved into: Activation peptide fragment 1; Activation peptide fragment 2; Thrombin light chain; Thrombin heavy chain]

Protein function

Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostasis, inflammation and wound healing. Activates co

PDB

1A2C , 1A3B , 1A3E , 1A46 , 1A4W , 1A5G , 1A61 , 1ABI , 1ABJ , 1AD8 , 1AE8 , 1AFE , 1AHT , 1AI8 , 1AIX , 1AWF , 1AWH , 1AY6 , 1B5G , 1B7X , 1BA8 , 1BB0 , 1BCU , 1BHX , 1BMM , 1BMN , 1BTH , 1C1U , 1C1V , 1C1W , 1C4U , 1C4V , 1C4Y , 1C5L , 1C5N , 1C5O , 1CA8 , 1D3D , 1D3P , 1D3Q , 1D3T , 1D4P , 1D6W , 1D9I , 1DE7 , 1DIT , 1DM4 , 1DOJ , 1DWB , 1DWC , 1DWD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00594	Gla	48 → 88	Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain	Domain
PF00051	Kringle	108 → 186	Kringle domain	Domain
PF00051	Kringle	213 → 291	Kringle domain	Domain
PF09396	Thrombin_light	316 → 363	Thrombin light chain	Domain
PF00089	Trypsin	364 → 613	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma.

Sequence

MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE

Sequence length

622

Interactions

View interactions

	KEGG		Reactome
	Phospholipase D signaling pathway Neuroactive ligand-receptor interaction Complement and coagulation cascades Platelet activation Regulation of actin cytoskeleton Pathogenic Escherichia coli infection Coronavirus disease - COVID-19 Pathways in cancer		Intrinsic Pathway of Fibrin Clot Formation Common Pathway of Fibrin Clot Formation Gamma-carboxylation of protein precursors Transport of gamma-carboxylated protein precursors from the endoplasmic reticulum to the Golgi apparatus Removal of aminoterminal propeptides from gamma-carboxylated proteins Cell surface interactions at the vascular wall Peptide ligand-binding receptors Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) G alpha (q) signalling events Thrombin signalling through proteinase activated receptors (PARs) Platelet Aggregation (Plug Formation) Regulation of Complement cascade

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Thrombophilia	Thrombophilia due to thrombin defect	rs121918477, rs387907201	N/A

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Cerebral palsy	cerebral palsy	N/A	N/A	ClinVar
Ischemic Stroke	ischemic stroke	N/A	N/A	ClinVar
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (345)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abnormalities Drug Induced	Associate	17454173
Abortion Habitual	Associate	26060483, 27525841, 28819944
Abortion Spontaneous	Associate	11190900, 16138341, 18627609, 18931510, 25153695, 28488549, 36554381
Abruptio Placentae	Associate	12857557
Activated Protein C Resistance	Associate	10233368, 8573079
Activated Protein C Resistance	Inhibit	11703344
Acute Disease	Associate	16649726
Acute Lung Injury	Associate	31054328
Acute On Chronic Liver Failure	Associate	38111573
Afibrinogenemia	Associate	10688828, 33668986
Airway Remodeling	Associate	15265805
Alzheimer Disease	Associate	21163861, 27553758, 30361890, 31197037, 8362984, 9258892
Amaurosis Fugax	Associate	17456620, 24175578, 35570827
Anemia Sickle Cell	Associate	11298605, 11535535, 11719358, 12560240, 22052675, 22084413, 31648337, 35822297, 9723576
Angina Unstable	Associate	10583928
Antiphospholipid Syndrome	Associate	10726001, 24175578, 34567006, 36012233
Antithrombin deficiency type 2	Associate	28743742, 30608445
Antithrombin III Deficiency	Associate	25811371, 32422680, 38309434
Antithrombin III Deficiency	Stimulate	37201530, 37670493
Aortic Valve Stenosis	Associate	27010400
Arterial Occlusive Diseases	Associate	17985012
Arthritis	Associate	24385683
Arthritis Psoriatic	Associate	9008232
Arthritis Rheumatoid	Associate	12176812, 18787303, 22674286, 24385683
Asthma	Associate	24831437
Astrocytoma	Associate	15447683, 7650024
Atherosclerosis	Associate	10027711, 15009462, 23335513, 26826018, 26915609, 27010400, 31467874, 37046189, 7806495, 8163952, 8226804
Atherosclerosis	Stimulate	33874983
Atrial Fibrillation	Stimulate	18452786
Atrial Fibrillation	Associate	19459131, 24041930, 28747025
Autoimmune Diseases	Associate	10792380
Behcet Syndrome	Associate	12780409
Bernard Soulier Syndrome	Associate	8407908
beta Thalassemia	Associate	10606878, 12560240
beta Thalassemia	Stimulate	9233563
Blood Coagulation Disorders	Associate	11435303, 12149217, 12621026, 16230339, 17456629, 17509570, 19265041, 19652200, 20102484, 21488867, 2172989, 22419573, 22906349, 23411429, 24158387 View all (21 more)
Blood Coagulation Disorders	Stimulate	17492768, 26826018
Blood Coagulation Disorders Inherited	Associate	40117674
Blood Loss Surgical	Associate	28651907
Blood Platelet Disorders	Associate	10397718, 12361206, 19483159, 22543060, 26247237, 30410927, 32759504, 32761872, 3487353, 36179652, 3801671, 6546700
Blood Platelet Disorders	Stimulate	12466243, 15201252, 18665927, 18979364, 22212092, 22459907, 23578283, 29284605, 29470443, 2981587, 32036486, 32218020, 32649856, 37563135, 6508753 View all (7 more)
Brain Edema	Associate	30562971
Brain Infarction	Associate	10567604
Brain Ischemia	Associate	17188740, 35197442, 35570827, 9572989
Breast Neoplasms	Associate	10027305, 14966279, 15033664, 28187434, 31962001, 32854772
Brugada Syndrome	Stimulate	23276942
Budd Chiari Syndrome	Associate	11001884, 12942460
Buruli Ulcer	Associate	26181660
Calciphylaxis	Associate	29238798
Capillary Leak Syndrome	Stimulate	20664062
Carcinogenesis	Stimulate	11861279
Carcinogenesis	Associate	17695537
Carcinoma Hepatocellular	Associate	21659380, 25591763
Carcinoma Intraductal Noninfiltrating	Stimulate	31962001
Carcinoma Ovarian Epithelial	Associate	20352429, 28148395
Carcinoma Renal Cell	Associate	22065054
Cardiovascular Diseases	Associate	26286125, 32649856, 35708029
Carotid Artery Thrombosis	Associate	12871361, 15240970, 19353312
Cartilage Diseases	Associate	24385683
Central Nervous System Diseases	Associate	12871361
Cerebral Arterial Diseases	Associate	9572989
Cerebral Hemorrhage	Associate	28662718, 33175864, 33955515
Cerebral Infarction	Associate	10572079, 17456629, 24355932, 25063764, 26286125, 32769241, 34087973
Cerebral Palsy	Associate	22098125
Cerebrovascular Disorders	Associate	9572989
Chromosome Aberrations	Associate	26060483
Chronic Disease	Associate	25992517
Chronic Limb Threatening Ischemia	Associate	26148006
Chronic Periodontitis	Associate	10776921
Chronic Urticaria	Associate	37646031
Cleft Palate	Associate	34609416
Coagulation Protein Disorders	Associate	31271700
Colitis Ulcerative	Associate	19439852
Colonic Neoplasms	Associate	1517149, 8611404, 9820166
Colonic Neoplasms	Inhibit	39212570
Colorectal Neoplasms	Associate	12707033, 21907696, 30462538, 30542696, 33625532
Congenital Abnormalities	Associate	12149217
Congenital Disorders of Glycosylation	Stimulate	31271700
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	14527888
Congenital Plasminogen Deficiency	Associate	31469483
Congenital thrombotic disease due to Protein C deficiency	Associate	7961868
Constriction Pathologic	Associate	19307078
Corneal Endothelial Cell Loss	Associate	32792588
Coronary Aneurysm	Associate	17188740
Coronary Artery Disease	Associate	10929044, 12204058, 15201277, 18278189, 18452260, 19353312, 20002542, 20626623, 32525847
Coronary Disease	Associate	18278189, 22359579, 22388798, 23426025, 9292507
COVID 19	Associate	34061792, 35511137, 36696180
Craniocerebral Trauma	Associate	18387654
Critical Illness	Inhibit	35196304
Cystic Fibrosis	Associate	1569186, 32668165
Death	Associate	12296757
Death	Stimulate	35295285
Diabetes Mellitus	Stimulate	15201277, 25298619
Diabetes Mellitus	Associate	19438723, 21935671, 22359579, 23426025
Diabetes Mellitus Type 1	Associate	37537394
Diabetes Mellitus Type 2	Associate	19755774, 26742564, 33441513
Disseminated Intravascular Coagulation	Associate	29257196
Down Syndrome	Associate	19399328
Drug Hypersensitivity	Associate	35708029
Drug Related Side Effects and Adverse Reactions	Associate	25944790, 28662718
Dysfibrinogenemia Congenital	Associate	8770228
Dysprothrombinemia	Associate	1334372, 14629473, 2752109, 28196451, 34256393, 9490687
Endotoxemia	Associate	37949000
Epilepsy	Associate	25992517
Epilepsy Tonic Clonic	Associate	36710196
Eye Hemorrhage	Associate	11549610
Factor V Deficiency	Associate	16359508, 18695002, 19861681, 33605529, 37866515, 7655011
Factor V Deficiency	Inhibit	21320286
Factor VII Deficiency	Associate	12881304, 22426302, 40117674
Factor X Deficiency	Associate	18245654, 25179519, 34680916
Factor XI Deficiency	Associate	25911238, 9573017
Factor XII Deficiency	Associate	22419573
Factors VIII IX And XI Combined Deficiency of	Associate	37866515
Familial antiphospholipid syndrome	Associate	12139749
Farber Lipogranulomatosis	Inhibit	27436851
Farber Lipogranulomatosis	Associate	32634856
Fetal Diseases	Associate	12871361, 14573785
Fetal Growth Retardation	Associate	14573785, 30313110
Fetal Growth Retardation	Stimulate	29658436
Fetal Membranes Premature Rupture	Associate	20709392
Fibrosarcoma	Associate	19182372
Fibrosis	Associate	12865283, 22174551, 23785453, 29577605, 36355755, 38309434
Flaujeac factor deficiency	Associate	7901207
Foramen Ovale Patent	Associate	12511746
Fractures Spontaneous	Associate	22359579
Genital Diseases Female	Associate	18591179
Genital Neoplasms Female	Associate	18591179
Glioblastoma	Associate	17958740, 26459764
Glioma	Associate	17958740, 33947134
Gliosis	Stimulate	27553758
Glomerulonephritis	Associate	8163952
Glucose Metabolism Disorders	Stimulate	30268122
Glut1 Deficiency Syndrome	Associate	27553758
Graft vs Host Disease	Associate	37563135
Gray Platelet Syndrome	Associate	17137471
Hearing Loss Sudden	Associate	18160602
Heart Diseases	Associate	22543060
Heart Failure	Associate	36179652
Heart Septal Defects Atrial	Associate	20552683
HELLP Syndrome	Associate	12519104
Hemangioma Cavernous Central Nervous System	Associate	37030452
Hemoglobinuria Paroxysmal	Stimulate	32311169
Hemophilia A	Associate	12487778, 1569180, 15705787, 16015425, 17059471, 19563500, 2104766, 21605333, 21899664, 21933309, 2499363, 2506948, 3137981, 32430703
Hemophilia B	Associate	2752109
Hemophilia B	Stimulate	8427961
Hemorrhage	Associate	11418471, 12149217, 17160994, 18055987, 18492116, 19563500, 19861681, 19959486, 21899664, 21933309, 22098125, 2298753, 25179519, 27975099, 29471734 View all (6 more)
Hemorrhagic Disorders	Associate	12149217, 16680739, 18245654
Hemorrhagic Stroke	Stimulate	35302736
Heparin Cofactor II Deficiency	Stimulate	37102605
Hepatic Encephalopathy	Associate	22906349
Hepatitis Alcoholic	Associate	36243044
Hepatitis B	Associate	31240230
Hepatitis C Chronic	Associate	22174551
Heredodegenerative Disorders Nervous System	Associate	25992517
HIV Infections	Associate	24759134, 30301959
Hodgkin Disease	Associate	36077307
Homocysteinemia	Associate	17985012, 22628232
Huntington Disease	Stimulate	21297956
Hypercholesterolemia	Associate	15629370
Hyperglycemia	Stimulate	25042561
Hyperhomocysteinemia	Stimulate	18612269
Hyperhomocysteinemia	Associate	22628232
Hyperinsulinism	Stimulate	25042561
Hyperprothrombinemia	Associate	14630828, 17461930
Hypertension	Associate	26915609, 8888689
Hypertension Portal	Associate	36646026
Hypodysfibrinogenemia Congenital	Associate	10880389, 15632207
Hypoglycemia	Stimulate	9721728
Hypoprothrombinemias	Associate	10567604, 1334372, 14629473, 15892853, 17002658, 17160994, 8839854
Hypoprothrombinemias	Inhibit	17002658
Hypoxia	Associate	35853902
Hypoxia Brain	Associate	22117975
Ichthyosis Lamellar	Associate	11874482
Idiopathic Pulmonary Fibrosis	Associate	25199049
IgA Vasculitis	Associate	10343541
Immunoglobulin G4 Related Disease	Associate	16246844
Immunologic Deficiency Syndromes	Associate	17059431
Infarction	Associate	10567604, 11190900
Infarction Middle Cerebral Artery	Associate	35197442
Infections	Associate	15927073, 1714592
Infectious Mononucleosis	Associate	10792380
Inflammation	Associate	10749718, 11447011, 11549610, 12176812, 16951492, 17728394, 18342628, 19265041, 20705603, 21239755, 22359579, 23426025, 24039253, 24453410, 24624928 View all (11 more)
Inflammation	Stimulate	12207328, 15201277, 22381244, 22842493, 23785453, 25298619, 29658436, 37046189
Inflammatory Bowel Diseases	Associate	29777136
Inflammatory Breast Neoplasms	Associate	23280128
Insulin Like Growth Factor I Resistance To	Associate	31648337
Insulin Resistance	Associate	26742564
Intestinal Diseases	Associate	11447011
Intracranial Embolism	Associate	34183315
Intracranial Thrombosis	Associate	16258669, 19022798, 23399370, 31025572, 32769241, 34137813, 37175682, 37442428, 9401066, 9632445
Iron Overload	Associate	24175578
Ischemic Attack Transient	Associate	24175578
Ischemic Stroke	Associate	32769241, 35790427, 37165007
Joint Diseases	Associate	8976643
Kidney Calculi	Associate	23029076, 23874695
Kidney Diseases	Associate	16760910, 33441513
Kidney Failure Chronic	Associate	9922347
Klinefelter Syndrome	Associate	19755774
Lateral Sinus Thrombosis	Associate	19022798
Legg Calve Perthes Disease	Associate	26438379
Leukemia	Associate	11841792, 21873357, 22419573, 7510689
Leukemia Lymphocytic Chronic B Cell	Stimulate	21812019
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	6932231
Liver Cirrhosis	Associate	26785615
Liver Diseases	Associate	18627609
Long QT Syndrome	Associate	40601919
Lung Diseases	Associate	16858010, 18342628, 19877031
Lung Injury	Associate	35295285
Lung Neoplasms	Stimulate	25861627
Lung Neoplasms	Associate	37654207
Lupus Erythematosus Systemic	Associate	12139749, 15247980, 16221206, 21239755, 23141924, 33874983
Malaria Cerebral	Associate	27624125
Medulloblastoma	Associate	25163932
Melanoma	Associate	20505748, 26504080
Mesenteric Ischemia	Associate	31875702
Metabolic Syndrome	Associate	20724652, 32093387
Mitochondrial Diseases	Associate	23303820
Mouth Neoplasms	Associate	16080493, 28339463
Multiple Sclerosis	Associate	33086557, 34561786
Muscle Neoplasms	Associate	632237
Muscular Dystrophy Duchenne	Stimulate	632237
Mycobacterium Infections	Associate	27686649
Mycobacterium Infections Nontuberculous	Associate	27686649
Myelodysplastic Syndromes	Associate	24410667
Myeloproliferative Disorders	Associate	11991237, 19438723
MYH9 Related Disorders	Associate	26247237
Myocardial Infarction	Associate	10027711, 10381497, 10987590, 12480694, 16015425, 16649726, 18387978, 21958997, 23382263, 25693916, 9292507
Myocardial Infarction	Stimulate	18278189
Myocardial Ischemia	Associate	10583928, 17456629
Nasal Polyps	Associate	35271862
Neointima	Associate	31197037
Neoplasm Metastasis	Associate	11395381, 18048360, 20352429, 22065054, 8611404
Neoplasm Metastasis	Stimulate	11861279, 31962001
Neoplasms	Associate	11395381, 15143072, 18048360, 18591179, 18988801, 20352429, 20445954, 21166500, 21423701, 22359579, 22419573, 23280128, 23426025, 24699825, 25407022 View all (15 more)
Neoplasms	Stimulate	18235964, 19438723, 37886852
Neoplasms by Site	Associate	10997988
Neoplastic Syndromes Hereditary	Associate	12560240, 15892853, 16432849, 22716977, 8839854
Nephrolithiasis Calcium Oxalate	Associate	26353961
Nerve Degeneration	Associate	30562971, 35197442
Nerve Degeneration	Stimulate	33175864
Netherton Syndrome	Associate	11874482, 22089833
Neuralgia	Associate	38521157
Neurodegenerative Diseases	Associate	22381244, 27553758
Neuroinflammatory Diseases	Associate	27553758, 30562971, 37030452
Obesity	Associate	19228864, 20148880
Obesity Morbid	Associate	20102484
Optic Nerve Hypoplasia	Associate	17454173
Osteoarthritis	Associate	23289928, 24385683
Osteogenesis imperfecta type 3	Stimulate	20378562
Osteonecrosis	Associate	23826780
Ovarian Neoplasms	Associate	15839837, 20352429
Pancreatic Neoplasms	Associate	22132114, 28573829
Pancreatitis Chronic	Associate	11950817, 16981266, 20543535, 22132114, 28573829, 31525466, 35723281
Paresis	Associate	16258669
Parkinson Disease	Associate	21163861
Pediatric Obesity	Associate	22098125
Periodic fever familial autosomal dominant	Stimulate	26823721, 30563869
Periodontal Diseases	Associate	10776921
Peripheral Arterial Disease	Associate	15768007, 15886665
Personality Disorders	Associate	23280128
Placenta Diseases	Associate	12857557
Plaque Amyloid	Associate	23592924
Plasminogen Activator Inhibitor 1 Deficiency	Stimulate	31469483
Polycystic Ovary Syndrome	Associate	17454173, 31173497
Polycythemia Vera	Associate	18768782
Polycythemia Vera	Stimulate	21442635
Porencephaly	Associate	25049278
Post Infectious Disorders	Associate	15733061
Pre Eclampsia	Associate	12519104, 17392178, 36963633
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10029588
Preeclamptic toxemia	Associate	12519104
Pregnancy Complications	Associate	14573785, 22642978
Preterm Premature Rupture of the Membranes	Associate	20709392
Primary Myelofibrosis	Associate	8238263
Prostatic Neoplasms	Associate	15143072, 16052512, 17492768, 23773523, 32692888
Protein C Deficiency	Associate	10567604, 1569192, 20012238, 22984498, 7961868
Protein C Deficiency	Stimulate	26785615
Protein C Deficiency	Inhibit	8353282
Protein Deficiency	Associate	7961868
Protein S Deficiency	Associate	10898277, 40419135
Protein S Deficiency	Inhibit	32347013
Protein S Deficiency	Stimulate	35616596
Proteinuria	Stimulate	33441513
Pseudotumor Cerebri	Associate	17454173
Pulmonary Disease Chronic Obstructive	Associate	21624643, 32758992
Pulmonary Embolism	Associate	16432849, 18057060, 18586684, 19399328, 19520679, 19755774, 26422681, 32649856
Purpura Thrombocytopenic Idiopathic	Associate	36696209
Pyruvate Carboxylase Deficiency Disease	Associate	16432849
Quebec platelet disorder	Inhibit	32761872
Renal Artery Obstruction	Associate	17456629
Renal Insufficiency	Associate	26247037
Retinal Artery Occlusion	Associate	35570827
Retinal Diseases	Associate	11549610
Retinal Vein Occlusion	Associate	10634550, 10726008, 10898280, 11001884, 12879433, 14527888, 15033664, 18160613, 18467536, 22147897, 22906349, 24282370, 26785615, 30057675, 34061792
Rupture	Stimulate	17188740
Sarcoma Kaposi	Associate	7507301
Sepsis	Stimulate	15201277
Sepsis	Associate	22842493, 31054328
Severe Acute Respiratory Syndrome	Associate	12487778
Sinistral Portal Hypertension	Associate	10898280
Sinus Thrombosis Intracranial	Associate	19439852
Skin Diseases Genetic	Inhibit	16374478
Sleep Apnea Obstructive	Associate	32036486, 35853902
Small Cell Lung Carcinoma	Associate	22065054
Soft Tissue Injuries	Associate	27566553
Stenosis Pulmonary Vein	Associate	11441986
Stillbirth	Associate	21945103
Stomach Neoplasms	Associate	26823721, 36189305, 38106450
Stroke	Associate	12871361, 15247980, 18627609, 24189452, 26286125, 31271700, 32649856, 37673933
Stroke	Stimulate	35790427
Takayasu Arteritis	Associate	10072118, 34523592
Thrombasthenia	Associate	2539213, 6826726
Thrombocythemia Essential	Associate	18768782, 23243278, 23873831, 31856623
Thrombocythemia Essential	Stimulate	21442635, 24009132
Thrombocytosis	Associate	23873831
Thromboembolism	Associate	11151062, 11167771, 12469051, 12749008, 16432849, 19022798, 19414836, 19438723, 30268122, 9861761
Thromboinflammation	Associate	37902278
Thrombophilia	Associate	10460623, 10898280, 11151062, 11190900, 15059842, 15497023, 1634610, 17262091, 17454173, 17456620, 17461930, 17895509, 18160613, 19414836, 19508974 View all (29 more)
Thrombophilia	Stimulate	21370218, 33923802, 35822297, 9326350
Thrombophilia hereditary	Associate	10477778, 11151062, 16760910, 18840629, 23114529, 28075532, 36017017
Thrombosis	Associate	10027711, 10194441, 10394164, 10440914, 10477778, 10666427, 10725983, 10779421, 10929044, 11151062, 11167765, 12044337, 12139755, 12296757, 12361206 View all (63 more)
Thrombotic Microangiopathies	Associate	19448164
Tomaculous neuropathy	Associate	1569192, 21320286, 25179519, 34680916
Tuberculosis	Associate	16258669
Upper Extremity Deep Vein Thrombosis	Associate	11190909
Uterine Hemorrhage	Associate	25529278, 29658436
Varicose Ulcer	Associate	12067473, 22565455
Vascular Diseases	Associate	16760910, 22359579, 23426025, 32382091
Vascular System Injuries	Stimulate	1328304
Vascular System Injuries	Associate	15817447, 17728394, 32430703, 7806495, 8163952, 8226804
Vasospasm Intracranial	Associate	31595394
Venous Thromboembolism	Associate	10029588, 10567604, 10666427, 10779421, 10930988, 10987590, 11071624, 11153741, 11167765, 11380448, 11471205, 12239149, 12447958, 12871543, 12871547 View all (57 more)
Venous Thrombosis	Associate	10027711, 10233439, 10477778, 10725983, 10929044, 11071624, 11151062, 11190909, 11229520, 11380448, 11441986, 12044337, 12067473, 12139755, 12296757 View all (50 more)
Ventricular Fibrillation	Associate	16649726, 22992348
Vitamin K Deficiency	Stimulate	33849479
Vitreoretinopathy Proliferative	Associate	29193875
von Willebrand Disease Type 3	Associate	30836803
von Willebrand Diseases	Associate	16680739, 18055987
Warfarin syndrome	Associate	9326187
Weight Loss	Inhibit	20102484
Williams Syndrome	Associate	7901207
Wiskott Aldrich Syndrome	Associate	10397718
Wounds and Injuries	Stimulate	31467874
Wounds and Injuries	Associate	8163684
Wounds Nonpenetrating	Associate	35196304

F2 (coagulation factor II, thrombin)