Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2121
Gene name Gene Name - the full gene name approved by the HGNC.
EvC ciliary complex subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EVC
Synonyms (NCBI Gene) Gene synonyms aliases
DWF-1, EVC1, EVCL
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p16.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein containing a leucine zipper and a transmembrane domain. This gene has been implicated in both Ellis-van Creveld syndrome (EvC) and Weyers acrodental dysostosis. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs35401386 G>A,C,T Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant
rs41269547 A>G Benign-likely-benign, likely-benign, conflicting-interpretations-of-pathogenicity Genic upstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs41269549 G>A Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity Genic upstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs41269557 G>A Likely-benign, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant
rs121908424 C>T Pathogenic Stop gained, coding sequence variant, genic downstream transcript variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018424 hsa-miR-335-5p Microarray 18185580
MIRT042772 hsa-miR-339-5p CLASH 23622248
MIRT037807 hsa-miR-455-3p CLASH 23622248
MIRT691894 hsa-miR-2278 HITS-CLIP 23313552
MIRT691893 hsa-miR-4768-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001501 Process Skeletal system development TAS 10700184
GO:0003416 Process Endochondral bone growth IEA
GO:0003416 Process Endochondral bone growth ISS
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604831 3497 ENSG00000072840
Protein
UniProt ID P57679
Protein name EvC complex member EVC (DWF-1) (Ellis-van Creveld syndrome protein)
Protein function Component of the EvC complex that positively regulates ciliary Hedgehog (Hh) signaling. Involved in endochondral growth and skeletal development.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Found in the developing vertebral bodies, ribs, upper and lower limbs, heart, kidney, lung.
Sequence
MARGGAACKSDARLLLGRDALRPAPALLAPAVLLGAALGLGLGLWLGCRAGRQRTRHQKD
DTQNLLKNLESNAQTPSETGSPSRRRKREVQMSKDKEAVDECEPPSNSNITAFALKAKVI
YPINQKFRPLADGSSNPSLHENLKQAVLPHQPVEASPSSSLGSLSQGEKDDCSSSSSVHS
ATSDDRFLSRTFLRVNAFPEVLACESVDVDLCIYSLHLKDLLHLDTALRQEKHMMFIQIF
KMCLLDLLPKKKSDDELYQKILSKQEKDLEELEKGLQVKLSNTEMSGAGDSEYITLADVE
KKEREYSEQLIDNMEAFWKQMANIQHFLVDQFKCSSSKARQLMMTLTERMIAAEGLLCDS
QELQALDALERTMGRAHMAKVIEFLKLQVQEETRCRLAAISHGLELLAGEGKLSGRQKEE
LLTQQHKAFWQEAERFSREFVQRGKDLVTASLAHQVEGTAKLTLAQEEEQRSFLAEAQPT
ADPEKFLEAFHEVLERQRLMQCDLEEEENVRATEAVVALCQELYFSTVDTFQKFVDALFL
QTLPGMTGLPPEECDYLRQEVQENAAWQLGKSNRFRRQQWKLFQELLEQDQQVWMEECAL
SSVLQTHLREDHEGTIRGVLGRLGGLTEESTRCVLQGHDLLLRSALRRLALRGNALATLT
QMRLSGKKHLLQELREQRALEQGSSQCLDEHQWQLLRALEARVLEEASRLEEEAQQTRLQ
LQQRLLAEAQEVGQLLQQHMECAIGQALLVHARNAATKSRAKDRDDFKRTLMEAAVESVY
VTSAGVSRLVQAYYQQIGRIMEDHEERKLQHLKTLQGERMENYKLRKKQELSNPSSGSRT
AGGAHETSQAVHQRMLSQQKRFLAQFPVHQQMRLHAQQQQAGVMDLLEAQLETQLQEAEQ
NFISELAALARVPLAESKLLPAKRGLLEKPLRTKRKKPLPQERGDLGVPNNEDLASGDQT
SGSLSSKRLSQQESEAGDSGNSKKMLKRRSNL
Sequence length 992
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Hedgehog signaling pathway   Hedgehog 'on' state
Activation of SMO
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ellis-Van Creveld Syndrome ellis-van creveld syndrome rs1300178432, rs767913372, rs1553894457, rs1553865346, rs794726665, rs909612975, rs1553876813, rs1553895776, rs1553876870, rs1262933856, rs764397417, rs748523193, rs1437174284, rs1485152854, rs121908424
View all (41 more)
N/A
Short-Rib Thoracic Dysplasia With Or Without Polydactyly Short-rib thoracic dysplasia 6 with or without polydactyly rs748523193, rs794726665, rs755381180, rs121908425 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Nephronophthisis nephronophthisis N/A N/A ClinVar
Prostate cancer Prostate cancer (SNP x SNP interaction) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ciliopathies Associate 33875766
Cleft Lip Associate 20087401
Cleft Palate Associate 20087401
Congenital Microtia Associate 24983964
Diabetes Mellitus Type 2 Associate 29273463
Dyslexia Associate 36514817
Dyslexia Acquired Associate 36514817
Ellis Van Creveld Syndrome Associate 17392984, 18947413, 20184732, 25908617, 29229899, 31338997, 36932784, 37157924, 37684519, 38531627
Heart Diseases Associate 17392984
Heart Septal Defects Atrial Associate 29229899