Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2114
Gene name Gene Name - the full gene name approved by the HGNC.
ETS proto-oncogene 2, transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ETS2
Synonyms (NCBI Gene) Gene synonyms aliases
ETS2IT1
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q22.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcription factor which regulates genes involved in development and apoptosis. The encoded protein is also a protooncogene and shown to be involved in regulation of telomerase. A pseudogene of this gene is located on the X chromosom
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004398 hsa-miR-199a-5p Microarray, Northern blot 16331254
MIRT000775 hsa-miR-199a-3p Microarray, Northern blot 16331254
MIRT024245 hsa-miR-218-5p Sequencing 20371350
MIRT050649 hsa-miR-18a-5p CLASH 23622248
MIRT045544 hsa-miR-149-5p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
ERF Repression 7588608
ETV7 Unknown 22615925
JUN Unknown 22354960
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12637547
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 12637547
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
164740 3489 ENSG00000157557
Protein
UniProt ID P15036
Protein name Protein C-ets-2
Protein function Transcription factor activating transcription. Binds specifically the DNA GGAA/T core motif (Ets-binding site or EBS) in gene promoters and stimulates transcription.
PDB 4BQA , 4MHV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02198 SAM_PNT 87 170 Sterile alpha motif (SAM)/Pointed domain Domain
PF00178 Ets 364 443 Ets-domain Domain
Sequence
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSIS
HDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATN
EFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKEN
QEKTEDQYEE
NSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFP
KSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQS
SLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRG
LRYYYDKNIIHKTSGKRYVYRFV
CDLQNLLGFTPEELHAILGVQPDTED
Sequence length 469
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ras signaling pathway
Human T-cell leukemia virus 1 infection
  Oncogene Induced Senescence
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Otosclerosis Otosclerosis N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Inhibit 23659968
Adenocarcinoma Associate 29761525
Adenocarcinoma of Lung Inhibit 23659968
Aortic Aneurysm Abdominal Associate 25993293
Arthritis Rheumatoid Associate 24089231, 34795667, 8660103
beta Thalassemia Associate 33069695
Blast Crisis Associate 33990592
Breast Neoplasms Associate 12628005, 15314206, 18586674, 20554528, 21526717, 23343470, 39796183
Carcinogenesis Associate 36760475
Carcinoma Hepatocellular Associate 36614238