Gene Gene information from NCBI Gene database.
Entrez ID 2101
Gene name Estrogen related receptor alpha
Gene symbol ESRRA
Synonyms (NCBI Gene)
ERR1ERRaERRalphaESRL1NR3B1
Chromosome 11
Chromosome location 11q13.1
Summary The protein encoded by this gene is a nuclear receptor that is most closely related to the estrogen receptor. This protein acts as a site-specific transcription factor and interacts with members of the PGC-1 family of transcription cofactors to regulate t
miRNA miRNA information provided by mirtarbase database.
183
miRTarBase ID miRNA Experiments Reference
MIRT006957 hsa-miR-137 Luciferase reporter assay 22723937
MIRT006957 hsa-miR-137 Luciferase reporter assay 22723937
MIRT016687 hsa-miR-423-3p Sequencing 20371350
MIRT020579 hsa-miR-155-5p Proteomics 18668040
MIRT028410 hsa-miR-30a-5p Proteomics 18668040
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
ESR1 Unknown 12960079
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin IBA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601998 3471 ENSG00000173153
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P11474
Protein name Steroid hormone receptor ERR1 (Estrogen receptor-like 1) (Estrogen-related receptor alpha) (ERR-alpha) (Nuclear receptor subfamily 3 group B member 1)
Protein function Binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. Can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promo
PDB 1XB7 , 2PJL , 3D24 , 3K6P , 7E2E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 77 146 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 224 404 Ligand-binding domain of nuclear hormone receptor Domain
Sequence
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLK
EGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI
SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL
EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKL
EGKVPMHKLFLEMLEA
MMD
Sequence length 423
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    PPARA activates gene expression
Transcriptional activation of mitochondrial biogenesis
Nuclear Receptor transcription pathway
Regulation of RUNX2 expression and activity