Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2100
Gene name	Estrogen receptor 2
Gene symbol	ESR2
Synonyms (NCBI Gene)	ER-BETAESR-BETAESRBESTRBErbNR3A2ODG8
Chromosome	14
Chromosome location	14q23.2-q23.3
Summary	This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cyto

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1567753148	T>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant

128

Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004563	hsa-miR-92a-3p	GFP reporter assay	20484043
MIRT017943	hsa-miR-335-5p	Microarray	18185580
MIRT054508	hsa-miR-30a-5p	Luciferase reporter assayMicroarrayNext Generation Sequencing (NGS)Western blot	24525454
MIRT683407	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT683406	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT683405	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT683404	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT683403	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT683402	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT683401	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT683400	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT683399	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT683398	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT683397	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT683396	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT683395	hsa-miR-302e	HITS-CLIP	23313552
MIRT683394	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT683393	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT683392	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT683391	hsa-miR-520b	HITS-CLIP	23313552
MIRT683390	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT683389	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT683388	hsa-miR-520e	HITS-CLIP	23313552
MIRT514543	hsa-miR-4438	HITS-CLIP	23313552
MIRT683387	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT683386	hsa-miR-140-5p	HITS-CLIP	23313552
MIRT683385	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT683384	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT683383	hsa-miR-520h	HITS-CLIP	23313552
MIRT683382	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT683381	hsa-miR-1224-3p	HITS-CLIP	23313552
MIRT683380	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT683379	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT683378	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT683377	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT683376	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT683375	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT683374	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT683373	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT683372	hsa-miR-203a-5p	HITS-CLIP	23313552
MIRT514532	hsa-miR-5095	HITS-CLIP	23313552
MIRT514533	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT683371	hsa-miR-6726-3p	HITS-CLIP	23313552
MIRT683370	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT514543	hsa-miR-4438	PAR-CLIP	23446348
MIRT514542	hsa-miR-3126-3p	PAR-CLIP	23446348
MIRT514541	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514540	hsa-miR-3176	PAR-CLIP	23446348
MIRT514539	hsa-miR-3922-3p	PAR-CLIP	23446348
MIRT514538	hsa-miR-4312	PAR-CLIP	23446348
MIRT514536	hsa-miR-2052	PAR-CLIP	23446348
MIRT514537	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT514535	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT514534	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT514532	hsa-miR-5095	PAR-CLIP	23446348
MIRT514533	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT514531	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT683407	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT683406	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT683405	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT683404	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT683403	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT683402	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT683401	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT683400	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT683399	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT683398	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT683397	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT683396	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT683395	hsa-miR-302e	HITS-CLIP	23313552
MIRT683394	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT683393	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT683392	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT683391	hsa-miR-520b	HITS-CLIP	23313552
MIRT683390	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT683389	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT683388	hsa-miR-520e	HITS-CLIP	23313552
MIRT514543	hsa-miR-4438	HITS-CLIP	23313552
MIRT683387	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT683386	hsa-miR-140-5p	HITS-CLIP	23313552
MIRT683385	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT683384	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT683383	hsa-miR-520h	HITS-CLIP	23313552
MIRT683382	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT683381	hsa-miR-1224-3p	HITS-CLIP	23313552
MIRT683380	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT683379	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT683378	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT683377	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT683376	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT683375	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT683374	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT683373	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT683372	hsa-miR-203a-5p	HITS-CLIP	23313552
MIRT514532	hsa-miR-5095	HITS-CLIP	23313552
MIRT514533	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT683371	hsa-miR-6726-3p	HITS-CLIP	23313552
MIRT683370	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT514543	hsa-miR-4438	PAR-CLIP	23446348
MIRT514542	hsa-miR-3126-3p	PAR-CLIP	23446348
MIRT514541	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514540	hsa-miR-3176	PAR-CLIP	23446348
MIRT514539	hsa-miR-3922-3p	PAR-CLIP	23446348
MIRT514538	hsa-miR-4312	PAR-CLIP	23446348
MIRT514536	hsa-miR-2052	PAR-CLIP	23446348
MIRT514537	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT514535	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT514534	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT514532	hsa-miR-5095	PAR-CLIP	23446348
MIRT514533	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT514531	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT970726	hsa-miR-4724-5p	CLIP-seq
MIRT970727	hsa-miR-7	CLIP-seq
MIRT970728	hsa-miR-3155	CLIP-seq
MIRT970729	hsa-miR-3155b	CLIP-seq
MIRT970730	hsa-miR-4265	CLIP-seq
MIRT970731	hsa-miR-4296	CLIP-seq
MIRT970732	hsa-miR-4322	CLIP-seq
MIRT970733	hsa-miR-4417	CLIP-seq
MIRT970734	hsa-miR-4640-5p	CLIP-seq
MIRT970735	hsa-miR-4726-5p	CLIP-seq
MIRT970736	hsa-miR-4786-3p	CLIP-seq
MIRT970737	hsa-miR-484	CLIP-seq
MIRT970738	hsa-miR-603	CLIP-seq
MIRT970739	hsa-miR-642b	CLIP-seq
MIRT1987595	hsa-miR-1295	CLIP-seq
MIRT1987596	hsa-miR-219-1-3p	CLIP-seq
MIRT1987597	hsa-miR-4717-5p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
STAT3	Activation	21546410
STAT5B	Unknown	11731618

Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15345745
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	15345745
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9636657
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	TAS	10749889
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	19126643
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	NAS	9671811
GO:0005496	Function	Steroid binding	IEA
GO:0005496	Function	Steroid binding	ISS
GO:0005496	Function	Steroid binding	TAS	11181953
GO:0005515	Function	Protein binding	IPI	11279242, 12904255, 14764652, 15199063, 18312651, 19022902, 19126643, 20074560, 21629692, 21951318, 24722188, 25416956, 25910212, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19126643, 20074560
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	11181953
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005739	Component	Mitochondrion	IDA	15024130
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	11181953
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007165	Process	Signal transduction	TAS	8769313, 10749889
GO:0007267	Process	Cell-cell signaling	TAS	8769313
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0019899	Function	Enzyme binding	IPI	12039952
GO:0030284	Function	Nuclear estrogen receptor activity	IDA	19126643, 24033289
GO:0030284	Function	Nuclear estrogen receptor activity	IEA
GO:0030284	Function	Nuclear estrogen receptor activity	IMP	29261182, 30113650
GO:0030284	Function	Nuclear estrogen receptor activity	TAS	11181953
GO:0030308	Process	Negative regulation of cell growth	NAS	11181953
GO:0030520	Process	Estrogen receptor signaling pathway	IBA
GO:0030520	Process	Estrogen receptor signaling pathway	IDA	24033289
GO:0030520	Process	Estrogen receptor signaling pathway	IEA
GO:0030520	Process	Estrogen receptor signaling pathway	TAS	11181953
GO:0034056	Function	Estrogen response element binding	IBA
GO:0034056	Function	Estrogen response element binding	IDA	15345745, 19126643, 24033289
GO:0034056	Function	Estrogen response element binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	20074560
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24033289
GO:0046872	Function	Metal ion binding	IEA
GO:0048019	Function	Receptor antagonist activity	NAS	9671811
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	10681512
GO:0071392	Process	Cellular response to estradiol stimulus	IDA	24033289
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA

MIM	HGNC	e!Ensembl
601663	3468	ENSG00000140009

Q92731

Protein name

Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)

Protein function

Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1/ER-alpha, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560). {ECO:0000269|P

PDB

1L2J , 1NDE , 1QKM , 1U3Q , 1U3R , 1U3S , 1U9E , 1X76 , 1X78 , 1X7B , 1X7J , 1YY4 , 1YYE , 1ZAF , 2FSZ , 2GIU , 2I0G , 2JJ3 , 2NV7 , 2QTU , 2YJD , 2YLY , 2Z4B , 3OLL , 3OLS , 3OMO , 3OMP , 3OMQ , 4J24 , 4J26 , 4ZI1 , 5TOA , 7XVY , 7XVZ , 7XWP , 7XWQ , 7XWR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12497	ERbeta_N	12 → 125	Estrogen receptor beta	Family
PF00105	zf-C4	147 → 216	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	283 → 482	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Expressed in testis and ovary, and at a lower level in heart, brain, placenta, liver, skeletal muscle, spleen, thymus, prostate, colon, bone marrow, mammary gland and uterus. Also found in uterine bone, breast, and ovarian

Sequence

MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ

Sequence length

530

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance Hormone signaling Estrogen signaling pathway Prolactin signaling pathway GnRH secretion Pathways in cancer Chemical carcinogenesis - receptor activation Breast cancer		PIP3 activates AKT signaling Constitutive Signaling by Aberrant PI3K in Cancer Nuclear Receptor transcription pathway PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling ESR-mediated signaling Extra-nuclear estrogen signaling

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Ovarian dysgenesis 8	Pathogenic	rs1567753148	RCV000721932

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs2274705	RCV005922941
ESR2-related disorder	Benign; Likely benign	rs1256049, rs17225885, rs944050, rs767711085, rs149404315, rs201005626, rs368248753, rs2550414301, rs60101369, rs1256054, rs78851986, rs2228481, rs1541060, rs111918185, rs139838202, rs142771803, rs201239439 View all (2 more)	RCV003980783 RCV003921321 RCV003975917 RCV003968568 RCV003971132 RCV003961244 RCV003929332 RCV003901922 RCV003926099 RCV003940521 RCV003920747 RCV003940645 RCV003932859 RCV003923012 RCV003958320 RCV003923163 RCV003925814
Familial cancer of breast	Benign	rs111918185	RCV005907580
Lung cancer	Benign	rs2274705	RCV005922943
Melanoma	Benign; Likely benign	rs74808355	RCV005908521
Thymoma	Benign	rs2274705	RCV005922942

Show/Hide Text Mining Associations (281)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Associate	15894829
Abortion Habitual	Associate	17895504
Acidosis	Stimulate	36499700
Adenocarcinoma	Associate	15517897, 19935673, 21733187, 25692143, 27003997, 29984337
Adenocarcinoma	Inhibit	15882182
Adenocarcinoma of Lung	Associate	19556604, 19875972, 21546410, 21862684, 22669742, 26301798, 34257530
Adenoma	Inhibit	34898546
Adenoma Pleomorphic	Associate	30390196
Adenomatous Polyposis Coli	Associate	27003997
Adenomatous Polyposis Coli	Inhibit	28681123, 29132333
Adenomatous Polyps	Inhibit	34898546
Adenomyosis	Associate	21444077, 23755957
Adrenocortical Carcinoma	Associate	33981288
Alzheimer Disease	Associate	18288931, 22156442
Alzheimer Disease	Inhibit	28389656
Aneuploidy	Associate	12750263
Angiomyolipoma	Associate	18374399
Anxiety Disorders	Associate	21570196
Arrest of spermatogenesis	Associate	18980759
Arthritis Juvenile	Associate	31616008
Arthritis Rheumatoid	Associate	16815861, 30174672
Asthma	Stimulate	31617730
Asthma	Associate	31638834
Astrocytoma	Inhibit	15141349
Ataxia Telangiectasia	Stimulate	26587829
Atherosclerosis	Associate	17110088
Barrett Esophagus	Associate	15517897
Bile Duct Neoplasms	Associate	20172949
Bone Diseases	Associate	26590813
Brain Injuries Traumatic	Associate	37418975
Brain Neoplasms	Associate	15141349, 23711151
Breast Diseases	Associate	16808847
Breast Neoplasms	Associate	10623650, 11308260, 11574541, 11598948, 11676856, 11734621, 11959119, 12736255, 12750263, 14745018, 15113861, 15477868, 16118406, 16219765, 16554735 View all (100 more)
Breast Neoplasms	Inhibit	11517191, 16760287, 16808847, 21435239, 25027393, 26276747, 35872983
Breast Neoplasms	Stimulate	24103091
Breast Neoplasms Male	Associate	23096432
Carcinogenesis	Associate	10835496, 11517191, 18021179, 19478391, 20920096, 21493669, 28681123, 36235125
Carcinogenesis	Inhibit	29017520, 37748565
Carcinoma Embryonal	Inhibit	19493328
Carcinoma Endometrioid	Stimulate	26036714
Carcinoma Endometrioid	Associate	29190668
Carcinoma Hepatocellular	Associate	12879470, 17191310, 26804600, 27757837, 27899088, 29085224, 34787087, 35007301
Carcinoma Hepatocellular	Inhibit	26006022
Carcinoma in Situ	Associate	29654370
Carcinoma Non Small Cell Lung	Associate	11413356, 16214508, 18701186, 19460433, 19706809, 20655613, 20802349, 21511357, 22302352, 24618619, 25310221, 26678909, 27706665, 29117942, 30022688 View all (6 more)
Carcinoma Ovarian Epithelial	Associate	10960636, 18704709, 19331143, 23497172, 24376209, 32992652, 34071938
Carcinoma Ovarian Epithelial	Inhibit	19032364, 22970307
Carcinoma Renal Cell	Associate	23460808, 26587829, 30017803
Carcinoma Signet Ring Cell	Associate	12073050
Carcinoma Transitional Cell	Associate	16700038
Carcinosarcoma	Stimulate	19200930
Carcinosarcoma	Associate	20605134
Cardiomyopathies	Associate	37306894
Cardiovascular Diseases	Associate	17702854, 19932075, 22324545, 25422593
Cartilage Diseases	Associate	22883423
Chemical and Drug Induced Liver Injury	Associate	26804600
Cholangiocarcinoma	Associate	16936263
Chronic Disease	Stimulate	27220899
Cognition Disorders	Associate	17889406, 23932494
Colitis Ulcerative	Inhibit	26497217, 31261736
Colonic Neoplasms	Associate	15545229, 20548329, 23055188, 40076925
Colorectal Neoplasms	Associate	14716825, 19478391, 19785773, 20548329, 20680712, 22759347, 22836803, 23055188, 23143558, 23149914, 25376484, 25650184, 26503819, 28681123, 28889324 View all (13 more)
Colorectal Neoplasms	Stimulate	16309230
Colorectal Neoplasms	Inhibit	21493669, 26339386, 29132333, 36293473
Coronary Artery Disease	Associate	17110088, 25973102, 34088265
Coronary Artery Disease	Inhibit	25973102
COVID 19	Inhibit	34718118
COVID 19	Associate	35676404
Crohn Disease	Inhibit	26497217, 31261736
Cytokine Release Syndrome	Associate	17548071
Death	Associate	19738412, 22828608, 25219910
Dementia	Associate	23491264
Dental Plaque	Associate	17110088
Dentofacial Deformities	Associate	35830136
Depressive Disorder Major	Associate	34566951
Desmoid disease hereditary	Associate	17077595, 20305341, 23035734
Developmental Disabilities	Associate	36235125
Diabetes Mellitus	Stimulate	36788175
Diabetes Mellitus Type 2	Associate	33902539
Disease	Associate	23932494, 27220899
Disorder of Sex Development 46 XY	Associate	29261182
Disorders of Sex Development	Associate	29261182
DNA Virus Infections	Associate	18663360, 29117942
Down Syndrome	Associate	22156442
Drug Related Side Effects and Adverse Reactions	Associate	12737316, 22439007, 25692143, 26590813, 32236598
Drug Related Side Effects and Adverse Reactions	Stimulate	27052470, 37913652
Drug Related Side Effects and Adverse Reactions	Inhibit	29247078
Dysbiosis	Associate	39456258
Dyslexia	Associate	22383464
Dysplastic Nevus Syndrome	Associate	34833446
Endocrine System Diseases	Associate	21492444, 26364046
Endometrial Hyperplasia	Associate	15882182, 26276747
Endometrial Neoplasms	Associate	11207052, 15579769, 15882182, 16884380, 17649817, 19758455, 21281625, 24338391, 24835059, 26036714, 26745067, 26930451, 31357971, 34510841, 36769338
Endometrial Neoplasms	Inhibit	23873111
Endometriosis	Associate	15193490, 16210018, 17336962, 17548071, 18048499, 19001520, 19878085, 20586553, 21476192, 21561608, 22520060, 24992181, 25029427, 26134036, 26827666 View all (7 more)
Endometriosis	Stimulate	17454161, 23749764
Eosinophilic Esophagitis	Associate	30578870
Esophageal Squamous Cell Carcinoma	Associate	22463081, 35645543
Euthyroid Sick Syndromes	Inhibit	29132333
Fatigue Syndrome Chronic	Inhibit	16731592
Fetal Growth Retardation	Inhibit	15983116
Fetal Growth Retardation	Associate	21832119
Fibroadenoma	Associate	16554735
Fibrocartilaginous embolism	Associate	33660790
Fibroma	Associate	16333857
Fibromatosis Aggressive	Associate	35048638
Fibrosis	Associate	29085224, 36207725
Flushing	Associate	26590813
Focal Epithelial Hyperplasia	Associate	32413024
Focal Nodular Hyperplasia	Inhibit	28947799
Follicular Cyst	Associate	34068748
Fractures Bone	Associate	16939403
Fragile X Syndrome	Associate	16939403
Gallbladder Neoplasms	Associate	22808109, 32024900
Genital Diseases Female	Associate	16382674
Glioma	Associate	23399685
Goiter Nodular	Associate	22936184
Granulosa Cell Tumor	Associate	28643774
Heart Diseases	Associate	30578870
Hepatitis B	Associate	18771580
Hepatopulmonary Syndrome	Associate	20346360
Hereditary Angioedema Type III	Associate	21392396, 23768005, 25411358, 35886868
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16760287, 18957107, 22622808, 28225892, 30705367, 31357971
Hernia Abdominal	Associate	32444257
Hidradenitis Suppurativa	Associate	39940809
Hodgkin Disease	Associate	21866462
Hydronephrosis	Associate	23612777
Hyperparathyroidism Secondary	Associate	11204421
Hyperplasia	Inhibit	15882182
Hypersensitivity Immediate	Associate	34566951
Hypertension	Associate	15894829, 28938457
Hypospadias	Associate	22341273, 32124842
Hypothyroidism Congenital Nongoitrous 2	Associate	33430114
Hypoxia	Inhibit	20385358
Hypoxia	Associate	20569445, 37748565
Hypoxia	Stimulate	22482968, 23399685
Hypoxia Brain	Inhibit	21435239, 37748565
Hypoxia Brain	Stimulate	23399685
Immune System Diseases	Stimulate	36788175
Infections	Associate	16046168
Infertility	Associate	21269226
Infertility Male	Associate	23913373, 26400324
Inflammation	Associate	21493669, 30174672, 33859619, 36175572, 39189559
Inflammation	Inhibit	26888479, 30864712
Inflammatory Bowel Diseases	Associate	26497217
Inflammatory Breast Neoplasms	Associate	22295107
Insulin Resistance	Associate	28472101
Intervertebral Disc Degeneration	Associate	33660790
Juvenile osteoporosis	Associate	37967683
Kidney Failure Chronic	Associate	16214508
Leigh syndrome French Canadian type	Associate	25692143
Leiomyoma	Associate	18166184, 19012097
Leiomyoma	Stimulate	27100507
Leishmaniasis Visceral	Associate	11384649
Leukemia	Associate	21683083
Liver Cirrhosis	Associate	36207725
Liver Cirrhosis Biliary	Associate	26608979
Liver Diseases	Associate	12879470, 17191310, 26804600
Lung Neoplasms	Associate	16214508, 21546410, 23619141, 25338663, 26678909, 31651857
Lymphatic Metastasis	Associate	20604969, 29190668, 35573183
Lymphatic Metastasis	Inhibit	21188569, 30705367
Lymphoma	Associate	29032728
Lymphoma B Cell	Inhibit	29032728
Lymphoma Large B Cell Diffuse	Associate	29032728
Lymphoma Non Hodgkin	Inhibit	27003997
Medulloblastoma	Associate	22439007
Melanoma	Associate	23812018, 26225426, 28643774, 34833446, 34990694, 36499700
Melanosis	Associate	35840442
Mesothelioma Malignant	Associate	21124760, 22011668, 27529370
Mitochondrial Diseases	Associate	33362719
Mohr Tranebjaerg syndrome	Associate	27706665
Mouth Diseases	Associate	16210018, 26827666
Muscular Dystrophy Duchenne	Associate	29320918
Muscular Dystrophy Facioscapulohumeral	Associate	28263188
Myasthenia Gravis	Associate	15661863
Myasthenia Gravis Autoimmune Experimental	Associate	15661863
Myocardial Infarction	Associate	17702854
Myoma	Associate	18166184
Neoplasm Invasiveness	Associate	11207052, 23923078
Neoplasm Invasiveness	Inhibit	24449868
Neoplasm Metastasis	Associate	15161636, 15958594, 18719363, 23149914, 30022688, 32657779, 36772966
Neoplasm Metastasis	Inhibit	21435239, 22970307, 27052470, 31792072, 32992652
Neoplasm Metastasis	Stimulate	24103091, 29190668
Neoplasms	Associate	10623650, 11676856, 11734621, 11857292, 15113861, 15141349, 15161636, 15254553, 15545229, 16214508, 16251631, 16309230, 16622466, 16700038, 16880783 View all (68 more)
Neoplasms	Inhibit	15147889, 16158045, 19528477, 20385358, 21435239, 22347418, 22828608, 22970307, 23055188, 23399685, 23460808, 24103091, 24552459, 25527409, 25931004 View all (8 more)
Neoplasms	Stimulate	21062926, 37668795
Neoplasms Adipose Tissue	Associate	18053221, 19111408
Neoplasms Germ Cell and Embryonal	Associate	19493328
Neoplasms Glandular and Epithelial	Associate	30649229
Neoplasms Neuroepithelial	Associate	25534237
Neuroblastoma	Associate	23584859
Neuroendocrine Tumors	Associate	25058880
Nevus	Associate	18177352
Nevus Pigmented	Associate	34833446
Non Muscle Invasive Bladder Neoplasms	Stimulate	27324053
Non Muscle Invasive Bladder Neoplasms	Associate	37668795
Obesity	Associate	18053221, 19111408, 26694100, 33902539, 35856485, 38003551
Obesity	Inhibit	35682668
Obesity Morbid	Associate	38003551
Osteoarthritis	Associate	16815861, 20131243, 39189559
Osteoporosis	Associate	17002564, 17889406, 24997336, 29320918, 29745905, 30556843
Osteoporotic Fractures	Associate	16939403
Osteosarcoma	Associate	32054506
Ovarian Cysts	Associate	11384649
Ovarian Diseases	Associate	10856486, 17454161, 21207255, 23749764, 28482871, 29629944, 30728052, 31878927
Ovarian Diseases	Inhibit	22970307
Ovarian Neoplasms	Associate	11384649, 15141349, 18704709, 19032364, 19331143, 21673961, 23176303, 23497172, 24376209, 28225892, 28482871, 28859612, 30326857, 32705198, 32856599, 32992652, 34207568 View all (2 more)
Overweight	Associate	19111408, 35573183
Pancreatic Diseases	Associate	21963730
Pancreatic Neoplasms	Associate	30373552
Parkinson Disease	Associate	20304699, 22155094
Parkinson Disease	Inhibit	21951066
Pelvic Organ Prolapse	Associate	22038234, 37430099
Periodic fever familial autosomal dominant	Associate	19386104
Peritoneal Diseases	Associate	11384649
Personality Disorders	Associate	28981526, 34665934
Phobic Disorders	Associate	21570196
Phyllodes Tumor	Associate	16554735
Pneumonia	Stimulate	31617730
Polycystic Ovary Syndrome	Associate	19185861, 30745857, 38281964
Polycystic Ovary Syndrome	Inhibit	21269226, 22296324, 25603724
Polycystic Ovary Syndrome	Stimulate	32482257
Polyps	Stimulate	21150157
Polyps	Associate	28681123
Polyps	Inhibit	29132333
Pre Eclampsia	Associate	15894829
Preeclamptic toxemia	Associate	15983116
Primary Ovarian Insufficiency	Associate	31692519, 36099812
Prodromal Symptoms	Associate	16214508
Prostate Cancer Hereditary 7	Associate	28981526
Prostatic Diseases	Associate	25527409
Prostatic Hyperplasia	Associate	28261681
Prostatic Hyperplasia	Inhibit	33031138
Prostatic Neoplasms	Associate	12122114, 15161636, 16756716, 18007998, 18505969, 18625043, 19363294, 19654868, 20385358, 20501637, 22114194, 22403175, 22549291, 22593181, 23487784 View all (26 more)
Prostatic Neoplasms	Inhibit	15958594, 21733187
Prostatic Neoplasms Castration Resistant	Associate	26010887, 28380417
Prostatitis	Inhibit	11438457, 20385358
Prostatitis	Associate	15147889, 18607069, 20501637, 21075385, 21733187, 23658372, 25816367, 36544211
Psychomotor Disorders	Associate	23932494
Retinal Dysplasia	Associate	15517897
Retinal Dysplasia	Inhibit	29132333
Rufous oculocutaneous albinism	Associate	19878085
Salivary Duct Calculi	Associate	30390196
Salivary Gland Neoplasms	Associate	26168722, 29385707
Scoliosis	Associate	25410117, 33339862, 35627124
Seminoma	Inhibit	19493328
Seminoma	Associate	22068818, 28459202
Sick Sinus Syndrome	Associate	18771580
Simpson Golabi Behmel syndrome	Associate	23190557
Smoke Inhalation Injury	Associate	25650184
Spondylometaepiphyseal Dysplasia Short Limb Hand Type	Associate	36901930
Squamous Cell Carcinoma of Head and Neck	Associate	19825947, 21205741, 28166815
Status Asthmaticus	Associate	29680290, 31617730
Stomach Neoplasms	Associate	12073050, 23199240, 26503819, 27781410, 27893427, 28388558
Stroke	Associate	39518968
Sweat Gland Diseases	Associate	26590813
Tertiary Lymphoid Structures	Associate	37682272
Testicular Neoplasms	Associate	22068818
Thymoma	Associate	21437890
Thymus Neoplasms	Associate	21437890
Thyroid Cancer Papillary	Associate	20372779, 22936184, 24114184, 24884830, 30705367
Thyroid Cancer Papillary	Inhibit	35162942
Thyroid Carcinoma Anaplastic	Stimulate	24114184
Thyroid Neoplasms	Associate	20372779, 26261608, 28643774
Thyroid Neoplasms	Inhibit	24114184
Thyroiditis	Associate	20067378
Tooth Erosion	Associate	31616008
Triple Negative Breast Neoplasms	Associate	18771580, 22266872, 24833090, 25874233, 26871946, 26968553, 27133732, 28003019, 30990221, 31792072, 32260128, 32678032, 33001337, 33050027, 34665934 View all (4 more)
Urethral Neoplasms	Associate	37338655
Urinary Bladder Neoplasms	Associate	16700038, 22965848, 23612777, 25048477, 26090392, 27324053, 37668795
Urinary Incontinence Stress	Stimulate	17963065
Urinary Incontinence Stress	Associate	29769420
Urologic Neoplasms	Associate	27052470, 27635763
Uterine Cervical Neoplasms	Associate	23923078
Uterine Cervicitis	Associate	23923078
Uterine Diseases	Associate	10835496, 20605134
Vascular System Injuries	Associate	17272673
Ventricular Remodeling	Inhibit	29680290
Vision Disorders	Associate	23932494
Weight Loss	Stimulate	35682668
Weight Loss	Associate	39427540

ESR2 (estrogen receptor 2)