FBL (fibrillarin)

Gene

• Entrez ID: 2091
• Gene name: Fibrillarin
• Gene symbol: FBL
• Synonyms (NCBI Gene): FIB, FLRN, Nop1, RNU3IP1
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the de

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050515	hsa-miR-20a-5p	CLASH	23622248
MIRT047276	hsa-miR-181b-5p	CLASH	23622248
MIRT043089	hsa-miR-324-5p	CLASH	23622248
MIRT989986	hsa-miR-144	CLIP-seq
MIRT989987	hsa-miR-2277-3p	CLIP-seq
MIRT989988	hsa-miR-3615	CLIP-seq
MIRT989989	hsa-miR-3660	CLIP-seq
MIRT989990	hsa-miR-4526	CLIP-seq
MIRT989991	hsa-miR-4709-5p	CLIP-seq
MIRT989992	hsa-miR-633	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000494	Process	Box C/D sno(s)RNA 3'-end processing	IBA
GO:0001094	Function	TFIID-class transcription factor complex binding	IPI	17636026
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0001650	Component	Fibrillar center	IDA
GO:0001650	Component	Fibrillar center	IEA
GO:0001652	Component	Granular component	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	1846968
GO:0005515	Function	Protein binding	IPI	10837141, 17498821, 17636026, 20926688, 21522132, 22720776, 22916032, 28514442, 29568061, 30540930, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	22720776
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	15494374, 16687569, 17158916, 19208757, 23203802, 24352239
GO:0005730	Component	Nucleolus	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006364	Process	RRNA processing	IEA
GO:0006364	Process	RRNA processing	TAS	1846968
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008649	Function	RRNA methyltransferase activity	IBA
GO:0015030	Component	Cajal body	IBA
GO:0015030	Component	Cajal body	IDA	16687569
GO:0015030	Component	Cajal body	IEA
GO:0016020	Component	Membrane	HDA	16210410
GO:0016074	Process	Sno(s)RNA metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031167	Process	RRNA methylation	IBA
GO:0031167	Process	RRNA methylation	IDA	30540930
GO:0031428	Component	Box C/D methylation guide snoRNP complex	IBA
GO:0031428	Component	Box C/D methylation guide snoRNP complex	NAS	17636026
GO:0032040	Component	Small-subunit processome	IBA
GO:0032040	Component	Small-subunit processome	IDA	34516797
GO:0032259	Process	Methylation	IEA
GO:0042274	Process	Ribosomal small subunit biogenesis	IDA	34516797
GO:0048254	Process	SnoRNA localization	IMP	17636026
GO:0051117	Function	ATPase binding	IPI	17636026
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0180021	Function	U6 snRNA 2'-O-ribose methyltransferase activity	IEA
GO:1990259	Function	Histone H2AQ104 methyltransferase activity	IBA
GO:1990259	Function	Histone H2AQ104 methyltransferase activity	IDA	24352239, 30540930
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 134795
• HGNC: 3599
• e!Ensembl: ENSG00000105202

Protein

• UniProt ID: P22087
• Protein name: rRNA 2'-O-methyltransferase fibrillarin (EC 2.1.1.-) (34 kDa nucleolar scleroderma antigen) (Histone-glutamine methyltransferase) (U6 snRNA 2'-O-methyltransferase fibrillarin)
• Protein function: S-adenosyl-L-methionine-dependent methyltransferase that has the ability to methylate both RNAs and proteins (PubMed:24352239, PubMed:30540930, PubMed:32017898). Involved in pre-rRNA processing by catalyzing the site-specific 2'-hydroxyl methyla
• PDB: 2IPX, 7MQ8, 7MQ9, 7MQA, 7SE6, 7SE7, 7SE8, 7SE9, 7SEA, 7SEB, 7SEC, 7SED
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01269	Fibrillarin	88 → 315	Fibrillarin	Domain

• Sequence:

  MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRG
  GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGE
  KRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDI
  VGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQP
  DQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLE
  PYERDHAVVVGVYRPPPKVKN

• Sequence length: 321

Pathways

KEGG:

Ribosome biogenesis in eukaryotes

Reactome:

Major pathway of rRNA processing in the nucleolus and cytosol