Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2078
Gene name Gene Name - the full gene name approved by the HGNC.	ETS transcription factor ERG
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ERG
Synonyms (NCBI Gene) Gene synonyms aliases	LMPHM14, erg-3, p55
Disease Acronyms (UniProt) Disease acronyms from UniProt database	LMPHM14
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q22.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apo

Show/Hide all(135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007094	hsa-miR-145-5p	Luciferase reporter assay	23480797
MIRT016692	hsa-miR-133b	Reporter assay	17344217
MIRT053340	hsa-miR-30a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23728339
MIRT053340	hsa-miR-30a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23728339
MIRT053341	hsa-miR-30b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23728339
MIRT053341	hsa-miR-30b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23728339
MIRT007094	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	27572146
MIRT734449	hsa-miR-223-5p	Luciferase reporter assay, qRT-PCR, Western blotting	32489464
MIRT736886	hsa-miR-362-3p	Luciferase reporter assay, qRT-PCR	31659098
MIRT737355	hsa-miR-200b-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32591615
MIRT968746	hsa-miR-105	CLIP-seq
MIRT968747	hsa-miR-106a	CLIP-seq
MIRT968748	hsa-miR-106b	CLIP-seq
MIRT968749	hsa-miR-130a	CLIP-seq
MIRT968750	hsa-miR-130b	CLIP-seq
MIRT968751	hsa-miR-136	CLIP-seq
MIRT968752	hsa-miR-141	CLIP-seq
MIRT968753	hsa-miR-17	CLIP-seq
MIRT968754	hsa-miR-19a	CLIP-seq
MIRT968755	hsa-miR-19b	CLIP-seq
MIRT968756	hsa-miR-200a	CLIP-seq
MIRT968757	hsa-miR-20a	CLIP-seq
MIRT968758	hsa-miR-20b	CLIP-seq
MIRT968759	hsa-miR-217	CLIP-seq
MIRT968760	hsa-miR-301a	CLIP-seq
MIRT968761	hsa-miR-301b	CLIP-seq
MIRT968762	hsa-miR-3166	CLIP-seq
MIRT968763	hsa-miR-3657	CLIP-seq
MIRT968764	hsa-miR-3666	CLIP-seq
MIRT968765	hsa-miR-4279	CLIP-seq
MIRT968766	hsa-miR-4295	CLIP-seq
MIRT968767	hsa-miR-4307	CLIP-seq
MIRT968768	hsa-miR-4503	CLIP-seq
MIRT968769	hsa-miR-454	CLIP-seq
MIRT968770	hsa-miR-4669	CLIP-seq
MIRT968771	hsa-miR-4771	CLIP-seq
MIRT968772	hsa-miR-486-5p	CLIP-seq
MIRT968773	hsa-miR-515-5p	CLIP-seq
MIRT968774	hsa-miR-519a	CLIP-seq
MIRT968775	hsa-miR-519b-3p	CLIP-seq
MIRT968776	hsa-miR-519c-3p	CLIP-seq
MIRT968777	hsa-miR-519d	CLIP-seq
MIRT968778	hsa-miR-548t	CLIP-seq
MIRT968779	hsa-miR-568	CLIP-seq
MIRT968780	hsa-miR-629	CLIP-seq
MIRT968781	hsa-miR-885-5p	CLIP-seq
MIRT968782	hsa-miR-891b	CLIP-seq
MIRT968783	hsa-miR-93	CLIP-seq
MIRT968784	hsa-miR-137	CLIP-seq
MIRT968785	hsa-miR-1237	CLIP-seq
MIRT968786	hsa-miR-1248	CLIP-seq
MIRT968787	hsa-miR-1253	CLIP-seq
MIRT968788	hsa-miR-1256	CLIP-seq
MIRT968789	hsa-miR-1258	CLIP-seq
MIRT968790	hsa-miR-1273e	CLIP-seq
MIRT968791	hsa-miR-1279	CLIP-seq
MIRT968752	hsa-miR-141	CLIP-seq
MIRT968792	hsa-miR-1915	CLIP-seq
MIRT968756	hsa-miR-200a	CLIP-seq
MIRT968759	hsa-miR-217	CLIP-seq
MIRT968793	hsa-miR-30a	CLIP-seq
MIRT968794	hsa-miR-30b	CLIP-seq
MIRT968795	hsa-miR-30c	CLIP-seq
MIRT968796	hsa-miR-30d	CLIP-seq
MIRT968797	hsa-miR-30e	CLIP-seq
MIRT968798	hsa-miR-3124-3p	CLIP-seq
MIRT968799	hsa-miR-3129-3p	CLIP-seq
MIRT968800	hsa-miR-340	CLIP-seq
MIRT968801	hsa-miR-3662	CLIP-seq
MIRT968802	hsa-miR-3663-5p	CLIP-seq
MIRT968803	hsa-miR-3978	CLIP-seq
MIRT968804	hsa-miR-4261	CLIP-seq
MIRT968765	hsa-miR-4279	CLIP-seq
MIRT968805	hsa-miR-4297	CLIP-seq
MIRT968806	hsa-miR-4317	CLIP-seq
MIRT968807	hsa-miR-4424	CLIP-seq
MIRT968768	hsa-miR-4503	CLIP-seq
MIRT968808	hsa-miR-4511	CLIP-seq
MIRT968809	hsa-miR-4528	CLIP-seq
MIRT968810	hsa-miR-4698	CLIP-seq
MIRT968811	hsa-miR-4726-3p	CLIP-seq
MIRT968812	hsa-miR-4797-5p	CLIP-seq
MIRT968813	hsa-miR-548b-3p	CLIP-seq
MIRT968814	hsa-miR-553	CLIP-seq
MIRT968815	hsa-miR-567	CLIP-seq
MIRT968816	hsa-miR-571	CLIP-seq
MIRT968817	hsa-miR-580	CLIP-seq
MIRT968780	hsa-miR-629	CLIP-seq
MIRT968818	hsa-miR-1200	CLIP-seq
MIRT968790	hsa-miR-1273e	CLIP-seq
MIRT968751	hsa-miR-136	CLIP-seq
MIRT968819	hsa-miR-4289	CLIP-seq
MIRT968806	hsa-miR-4317	CLIP-seq
MIRT968820	hsa-miR-4324	CLIP-seq
MIRT968821	hsa-miR-4672	CLIP-seq
MIRT968822	hsa-miR-544b	CLIP-seq
MIRT968792	hsa-miR-1915	CLIP-seq
MIRT1987127	hsa-miR-3130-3p	CLIP-seq
MIRT1987128	hsa-miR-3607-3p	CLIP-seq
MIRT968801	hsa-miR-3662	CLIP-seq
MIRT1987129	hsa-miR-3686	CLIP-seq
MIRT1987130	hsa-miR-370	CLIP-seq
MIRT968803	hsa-miR-3978	CLIP-seq
MIRT968805	hsa-miR-4297	CLIP-seq
MIRT1987131	hsa-miR-4652-3p	CLIP-seq
MIRT968810	hsa-miR-4698	CLIP-seq
MIRT968811	hsa-miR-4726-3p	CLIP-seq
MIRT1987132	hsa-miR-4776-3p	CLIP-seq
MIRT968816	hsa-miR-571	CLIP-seq
MIRT1987133	hsa-miR-626	CLIP-seq
MIRT968747	hsa-miR-106a	CLIP-seq
MIRT968748	hsa-miR-106b	CLIP-seq
MIRT968785	hsa-miR-1237	CLIP-seq
MIRT968786	hsa-miR-1248	CLIP-seq
MIRT968753	hsa-miR-17	CLIP-seq
MIRT968757	hsa-miR-20a	CLIP-seq
MIRT968758	hsa-miR-20b	CLIP-seq
MIRT2221526	hsa-miR-3137	CLIP-seq
MIRT2221527	hsa-miR-3182	CLIP-seq
MIRT1987128	hsa-miR-3607-3p	CLIP-seq
MIRT2221528	hsa-miR-3609	CLIP-seq
MIRT1987129	hsa-miR-3686	CLIP-seq
MIRT2221529	hsa-miR-4432	CLIP-seq
MIRT1987131	hsa-miR-4652-3p	CLIP-seq
MIRT2221530	hsa-miR-4780	CLIP-seq
MIRT2221531	hsa-miR-4796-3p	CLIP-seq
MIRT2221532	hsa-miR-499-5p	CLIP-seq
MIRT968777	hsa-miR-519d	CLIP-seq
MIRT2221533	hsa-miR-539	CLIP-seq
MIRT2221534	hsa-miR-548ah	CLIP-seq
MIRT2221535	hsa-miR-615-5p	CLIP-seq
MIRT2221536	hsa-miR-623	CLIP-seq
MIRT2221537	hsa-miR-758	CLIP-seq
MIRT2221538	hsa-miR-764	CLIP-seq
MIRT968783	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(8)

Transcription factor	Regulation	Reference
ERG	Activation	21536859
ETS1	Activation	7731694
ETS2	Activation	7731694
FLI1	Activation	21536859
GATA3	Activation	21536859
LMO2	Activation	21536859
LYL1	Activation	21536859
TAL1	Activation	21536859

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	23093599
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	18195090
GO:0003677	Function	DNA binding	TAS	8502479
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	20478527, 21575865, 22531786, 22722839, 27109047
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006468	Process	Protein phosphorylation	TAS	8502479
GO:0007165	Process	Signal transduction	TAS	8502479
GO:0007275	Process	Multicellular organism development	TAS	8502479
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18195090, 23913826
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18195090, 22235125
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661

MIM	HGNC	e!Ensembl
165080	3446	ENSG00000157554

Protein

UniProt ID

P11308

Protein name

Transcriptional regulator ERG (Transforming protein ERG)

Protein function

Transcriptional regulator. May participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.

PDB

1SXE , 4IRG , 4IRH , 4IRI , 5YBC , 5YBD , 6VGE , 6VGG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02198	SAM_PNT	122 → 205	Sterile alpha motif (SAM)/Pointed domain	Domain
PF00178	Ets	319 → 398	Ets-domain	Domain

Sequence

MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQP
PARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTT
NERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLT
PSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEA
TQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPYQILGPTS
SRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNM
NYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGS
YHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY

Sequence length

479

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer Prostate cancer

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
Aortic aneurysm	Aortic Aneurysm, Abdominal	rs1555554098, rs267606902, rs121434526, rs121434527, rs121434528, rs387906592, rs387906781, rs387906782, rs397516685, rs397514037, rs112901682, rs397515325, rs397515330, rs794728025, rs112602953 View all (29 more)	27899403
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	22843504
Leukemia	leukemia, Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2)	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	19108891, 19822134
Lymphoblastic leukemia	Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699 View all (13 more)	27776115
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	27386562
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	19396168, 25735316, 27783944, 28783165, 18798265, 17173048, 27223260

Show/Hide Unknown Diseases (9)

Disease term	Disease name	Evidence	Source
Unknown
Lymphatic Malformation	lymphatic malformation 14		GenCC
Multiple Sclerosis	Multiple Sclerosis		GWAS
Coronary artery disease	Coronary artery disease		GWAS
Hypertension	Hypertension		GWAS
Dermatitis	Dermatitis		GWAS
Dental caries	Dental caries		GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA
Myocardial Infarction	Myocardial Infarction		GWAS
Diabetes	Diabetes		GWAS

Show/Hide Text Mining Associations (142)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Habitual	Associate	28111453
Adenocarcinoma	Associate	19151660, 19734849, 21499236, 21499238, 21677539, 23686669, 24406865, 26178158, 26331372, 27272561, 28155973, 29949537, 30656528, 32639612, 32649013 View all (4 more)
Adenocarcinoma	Stimulate	21317715
Adenocarcinoma of Lung	Associate	40453647
Allan Herndon Dudley syndrome	Associate	26195723
amyloidosis IX	Associate	21178509, 30300367
Anemia	Associate	39604843
Aneuploidy	Associate	18711181
Aneurysm Ascending Aorta	Associate	33017217, 36142762
Aortic Aneurysm Abdominal	Associate	31691800, 34930827
Aortic Dissection	Associate	36142762, 39604843
Arrhythmias Cardiac	Associate	18059314, 18192214, 24152733, 28681507, 29297274, 34716268, 37740435
Ataxia Telangiectasia	Associate	25972242
Atherosclerosis	Inhibit	30892142
Atherosclerosis	Associate	31691800
Bacterial Infections	Stimulate	34341114
Bicuspid Aortic Valve Disease	Associate	36142762
Breast Neoplasms	Associate	24504051
Calcinosis	Associate	36142762
Candidiasis Chronic Mucocutaneous	Associate	32046674
Cap Myopathy	Associate	17259299, 20585344, 21178489, 24115221, 25808739, 25889691, 26844274, 26988912
Carcinogenesis	Associate	20479932, 27500376, 28186998, 30150711, 34801551, 40141159
Carcinogenesis	Stimulate	23913826, 28887309
Carcinoma Acinar Cell	Associate	26178158, 30658688
Carcinoma Adenosquamous	Associate	32639612
Carcinoma Ductal	Associate	40042161
Carcinoma Endometrioid	Associate	24175302
Carcinoma Giant Cell	Associate	32639612
Carcinoma Hepatocellular	Associate	32591615
Carcinoma Intraductal Noninfiltrating	Associate	23222491, 25517949
Carcinoma Non Small Cell Lung	Associate	32894545
Carcinoma Renal Cell	Associate	31348324, 32639612, 35624190
Carcinoma Small Cell	Associate	19465903, 21336263, 21499238
Cardiotoxicity	Associate	26526230
Cardiovascular Diseases	Associate	30892142
Cell Transformation Neoplastic	Associate	35508713
Central Nervous System Neoplasms	Associate	25881913
Chromosome 22 monosome mosaic	Associate	8040301
Chromosome 7 monosomy	Associate	15760896
Chromosome Aberrations	Associate	21499238
Cleft Palate	Associate	26331372
Congenital thrombotic disease due to Protein C deficiency	Associate	24469092, 37847647, 38477088
COVID 19	Associate	36709793, 37287057
Death	Associate	18694509, 18711181, 19205910, 20104229, 21372155, 22080055
Death Sudden	Associate	26152716
Death Sudden Cardiac	Associate	21158687, 37419691
Desmoplastic Small Round Cell Tumor	Associate	24517889
Diabetes Mellitus Type 2	Inhibit	28804970
Diabetes Mellitus Type 2	Associate	33562405
Down Syndrome	Associate	27134169, 28111453, 9037601
Encephalitis Herpes Simplex	Associate	18551196
Encephalitis Tick Borne	Stimulate	34083737
Endometrial Neoplasms	Associate	36814242
Fibrosarcoma	Associate	24517889
Fibrosis	Associate	36142762
Fused Kidney	Associate	31296150
Gastrointestinal Stromal Tumors	Associate	25239601
Genomic Instability	Associate	25915538
Glioblastoma	Associate	33040444, 37853449
Heart Arrest	Associate	24152733
Heart Diseases	Stimulate	30628647
Hemangioblastoma	Stimulate	25881913
Hemangioendothelioma	Associate	27515856
Hemangioendothelioma Epithelioid	Associate	21317715
Hemangiosarcoma	Associate	21317715, 23774169, 24707153, 30723294, 35440765
Hepatitis E	Associate	25972242
Hyperglycemia	Associate	12531891
Hypertension	Associate	34987319
Hypoglycemia	Inhibit	12531891
Hypomagnesemia primary	Associate	35508713
Hypoxia	Associate	18381358, 35508713
Infections	Stimulate	34341114
Inflammation	Associate	26909589, 27926866, 31691800, 35508713
Inflammation	Stimulate	34341114
Kashin Beck Disease	Associate	31220921
Laurin Sandrow syndrome	Associate	22135214
Leukemia	Associate	15800067, 23300998, 24068373, 24504051, 26909589, 27055868, 27494621, 28415578, 30630977, 34075404
Leukemia Erythroblastic Acute	Associate	33186348
Leukemia Lymphocytic Chronic B Cell	Associate	31054182
Leukemia Megakaryoblastic Acute	Associate	23380710
Leukemia Myeloid	Associate	10779324
Leukemia Myeloid Acute	Associate	10354136, 15007164, 19398719, 20026798, 20473283, 20841507, 21317715, 21596848, 21967978, 22983443, 23300998, 24068373, 24867525, 26148230, 26625814 View all (13 more)
Long QT Syndrome	Associate	10531299, 11741928, 12839862, 14975928, 15072950, 15760896, 16361248, 17965736, 18192214, 18471075, 18551196, 19029296, 19032804, 19668779, 19940115 View all (28 more)
Long Qt Syndrome 2	Associate	10531299, 15760896, 19029296, 26847485
Lung Neoplasms	Stimulate	18927117, 21317715
Lymphangioma	Associate	21317715
Lymphatic Metastasis	Associate	20018353, 36814242
Lymphoma Large B Cell Diffuse	Associate	31237044
Lymphoma Non Hodgkin	Associate	24297949
Melanoma	Associate	37217516
Mesothelioma	Associate	21317715
Multiple Sclerosis	Associate	27386562
Myoepithelioma	Associate	26261664
Myositis	Stimulate	34341114
Neoplasm Invasiveness	Associate	23661613, 27272561
Neoplasm Metastasis	Associate	19407851, 20018353, 21669963, 21937078, 24505269, 26331372, 26990456, 28555048, 30190183, 30656528, 35163398
Neoplasm Metastasis	Inhibit	22531786, 37759298
Neoplasm Metastasis	Stimulate	23334893, 34341114
Neoplasms	Associate	15846098, 17079440, 17172822, 17259299, 17971772, 17991527, 19407851, 19597533, 20068566, 20104229, 20124490, 20478527, 20479932, 20585344, 20601956 View all (123 more)
Neoplasms	Stimulate	23480797, 23686669, 26331372, 29309308
Neoplastic Cells Circulating	Associate	19339269
Neoplastic Syndromes Hereditary	Associate	25914329, 29907571
Neuroblastoma	Associate	15800067
Neuroectodermal Tumors	Associate	8022439
Neuroectodermal Tumors Primitive Peripheral	Associate	8577710
Obesity	Associate	24292212, 25852077, 29167279
Periodontitis	Associate	34852650
Peripheral Nervous System Neoplasms	Associate	20693982
Peritonitis	Associate	36928819
Personality Disorders	Associate	28652740
Precancerous Conditions	Associate	34341114
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	28415578, 39202339, 39940843
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	21680795, 23300998, 27055868, 27494621, 27776115, 28415578, 30510082, 30630977, 31237044, 35083818, 36350827, 37216686, 39940843
Precursor Cell Lymphoblastic Leukemia Lymphoma	Stimulate	26909589
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	21835957, 22570408, 23300998, 24504051, 27604872
Prostatic Intraepithelial Neoplasia	Associate	17032499, 19407851, 20585344, 21499236, 22849743, 23222491, 24297949, 26331372, 27272561, 35508713
Prostatic Neoplasms	Associate	16820092, 17059688, 17079440, 17172822, 17259299, 17334343, 17334351, 17385188, 17401460, 17632455, 17637754, 17971772, 17991527, 18065961, 18165275 View all (276 more)
Prostatic Neoplasms	Stimulate	28419548
Prostatic Neoplasms Castration Resistant	Associate	19339269, 21170267, 22722839, 24098661, 24469092, 25043157, 25420520, 25593303, 25754347, 26990456, 27391263, 27863438, 31619598
Prostatic Neoplasms Castration Resistant	Stimulate	27223260
Prostatitis	Associate	17032499, 17334351, 18065961, 18694509, 18794177, 18948370, 19190343, 19339269, 19465903, 20479932, 20585344, 20693982, 21178489, 21317715, 21499238 View all (45 more)
Prostatitis	Stimulate	24406865
Pyruvate Carboxylase Deficiency Disease	Associate	24469092, 37642075
Rhabdomyosarcoma Alveolar	Associate	24517889
Ring Chromosome 20 Syndrome	Associate	32046674
Sarcoma	Associate	24072183, 26261664, 31645347, 35440765
Sarcoma Ewing	Associate	12186432, 12736494, 17620387, 18212050, 18310898, 21317715, 23185447, 23774169, 24517889, 24667836, 24723486, 28643791, 31237044, 32362012, 34009296 View all (7 more)
Sarcoma Kaposi	Associate	21317715
Sarcoma Myeloid	Associate	21317715, 35623083, 36916780
Schizophrenia	Associate	33562405
Sleep Apnea Obstructive	Associate	34987319
ST Elevation Myocardial Infarction	Associate	26367242
Stomach Neoplasms	Associate	15846098
Stomach Neoplasms	Inhibit	37759298
Tarlov Cysts	Stimulate	30658688
Thyroid Carcinoma Anaplastic	Associate	23569377
Torsades de Pointes	Associate	18059314, 23812503, 29297274, 31347753
Tricuspid Atresia	Associate	36142762
Triple Negative Breast Neoplasms	Associate	28590426
Varicose Veins	Associate	36653477
Vascular Neoplasms	Associate	21317715
Vulvar Neoplasms	Associate	26261664

ERG (ETS transcription factor ERG)