Gene Gene information from NCBI Gene database.
Entrez ID 2069
Gene name Epiregulin
Gene symbol EREG
Synonyms (NCBI Gene)
EPREREp
Chromosome 4
Chromosome location 4q13.3
Summary This gene encodes a secreted peptide hormone and member of the epidermal growth factor (EGF) family of proteins. The encoded protein is a ligand of the epidermal growth factor receptor (EGFR) and the structurally related erb-b2 receptor tyrosine kinase 4
miRNA miRNA information provided by mirtarbase database.
554
miRTarBase ID miRNA Experiments Reference
MIRT016703 hsa-miR-335-5p Microarray 18185580
MIRT022139 hsa-miR-124-3p Microarray 18668037
MIRT437629 hsa-miR-150-5p MicroarrayqRT-PCR 22815788
MIRT437656 hsa-miR-181a-5p MicroarrayqRT-PCR 22815788
MIRT437753 hsa-miR-93-5p MicroarrayqRT-PCR 22815788
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
KDM2A Repression 23074094
NFIL3 Unknown 1620116
WT1 Unknown 17430890
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
81
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001550 Process Ovarian cumulus expansion IEA
GO:0001550 Process Ovarian cumulus expansion ISS
GO:0001556 Process Oocyte maturation IEA
GO:0001556 Process Oocyte maturation ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602061 3443 ENSG00000124882
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14944
Protein name Proepiregulin [Cleaved into: Epiregulin (EPR)]
Protein function Ligand of the EGF receptor/EGFR and ERBB4. Stimulates EGFR and ERBB4 tyrosine phosphorylation (PubMed:9419975). Contributes to inflammation, wound healing, tissue repair, and oocyte maturation by regulating angiogenesis and vascular remodeling a
PDB 1K36 , 1K37 , 5E8D , 5WB7 , 7LEN , 7LFR , 7LFS , 8HGP
Family and domains
Tissue specificity TISSUE SPECIFICITY: In normal adults, expressed predominantly in the placenta and peripheral blood leukocytes. High levels were detected in carcinomas of the bladder, lung, kidney and colon. {ECO:0000269|PubMed:9337852}.
Sequence
MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
AQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVA
LTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
Sequence length 169
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
ErbB signaling pathway
PI3K-Akt signaling pathway
Colorectal cancer
  Signaling by ERBB2
Signaling by ERBB4
SHC1 events in ERBB2 signaling
PI3K events in ERBB4 signaling
SHC1 events in ERBB4 signaling
PIP3 activates AKT signaling
Signaling by EGFR
GRB2 events in EGFR signaling
GAB1 signalosome
SHC1 events in EGFR signaling
EGFR downregulation
GRB2 events in ERBB2 signaling
PI3K events in ERBB2 signaling
EGFR interacts with phospholipase C-gamma
Constitutive Signaling by Aberrant PI3K in Cancer
Inhibition of Signaling by Overexpressed EGFR
RAF/MAP kinase cascade
ERBB2 Regulates Cell Motility
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
ERBB2 Activates PTK6 Signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Downregulation of ERBB2 signaling
Extra-nuclear estrogen signaling
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 TMD/JMD mutants