Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2066
Gene name Gene Name - the full gene name approved by the HGNC.	Erb-b2 receptor tyrosine kinase 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ERBB4
Synonyms (NCBI Gene) Gene synonyms aliases	ALS19, HER4, p180erbB4
Disease Acronyms (UniProt) Disease acronyms from UniProt database	ALS19
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q34
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the Tyr protein kinase family and the epidermal growth factor receptor subfamily. It encodes a single-pass type I membrane protein with multiple cysteine rich domains, a transmembrane domain, a tyrosine kinase domain, a phosphotid

Show/Hide all(11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs55671017	G>A,T	Likely-pathogenic, benign	Coding sequence variant, missense variant, synonymous variant
rs202247795	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs267599192	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs267599193	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs397514262	C>T	Pathogenic	Coding sequence variant, missense variant
rs397514263	G>A	Pathogenic	Coding sequence variant, missense variant
rs535202189	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs776347334	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1553563398	AG>-	Likely-pathogenic	Genic upstream transcript variant, stop gained, coding sequence variant
rs1574867228	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1575051224	C>T	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all(379)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003534	hsa-miR-302d-3p	Luciferase reporter assay, Microarray	19885849
MIRT003533	hsa-miR-19a-3p	Luciferase reporter assay, Microarray	19885849
MIRT003533	hsa-miR-19a-3p	Luciferase reporter assay, Microarray	19885849
MIRT003532	hsa-miR-372-3p	Luciferase reporter assay, Microarray	19885849
MIRT005806	hsa-miR-146a-5p	Luciferase reporter assay, Microarray, Western blot	20864407
MIRT053661	hsa-miR-145-5p	Microarray	22942087
MIRT053704	hsa-miR-221-3p	Microarray	22942087
MIRT054800	hsa-miR-302b-3p	Luciferase reporter assay, qRT-PCR, Western blot	24438167
MIRT005806	hsa-miR-146a-5p	Luciferase reporter assay, Northern blot	23619365
MIRT734720	hsa-miR-323a-3p	Luciferase reporter assay, qRT-PCR	33219358
MIRT755371	hsa-miR-23a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	37290686
MIRT968025	hsa-miR-1193	CLIP-seq
MIRT968026	hsa-miR-1246	CLIP-seq
MIRT968027	hsa-miR-1252	CLIP-seq
MIRT968028	hsa-miR-1273e	CLIP-seq
MIRT968029	hsa-miR-1290	CLIP-seq
MIRT968030	hsa-miR-1293	CLIP-seq
MIRT968031	hsa-miR-1299	CLIP-seq
MIRT968032	hsa-miR-1303	CLIP-seq
MIRT968033	hsa-miR-1305	CLIP-seq
MIRT968034	hsa-miR-137	CLIP-seq
MIRT968035	hsa-miR-2278	CLIP-seq
MIRT968036	hsa-miR-299-3p	CLIP-seq
MIRT968037	hsa-miR-3065-5p	CLIP-seq
MIRT968038	hsa-miR-3074-5p	CLIP-seq
MIRT968039	hsa-miR-3124-3p	CLIP-seq
MIRT968040	hsa-miR-3129-3p	CLIP-seq
MIRT968041	hsa-miR-3134	CLIP-seq
MIRT968042	hsa-miR-3138	CLIP-seq
MIRT968043	hsa-miR-3143	CLIP-seq
MIRT968044	hsa-miR-3158-5p	CLIP-seq
MIRT968045	hsa-miR-3167	CLIP-seq
MIRT968046	hsa-miR-3202	CLIP-seq
MIRT968047	hsa-miR-326	CLIP-seq
MIRT968048	hsa-miR-329	CLIP-seq
MIRT968049	hsa-miR-330-3p	CLIP-seq
MIRT968050	hsa-miR-330-5p	CLIP-seq
MIRT968051	hsa-miR-335	CLIP-seq
MIRT968052	hsa-miR-3529	CLIP-seq
MIRT968053	hsa-miR-3613-3p	CLIP-seq
MIRT968054	hsa-miR-362-3p	CLIP-seq
MIRT968055	hsa-miR-3653	CLIP-seq
MIRT968056	hsa-miR-3658	CLIP-seq
MIRT968057	hsa-miR-3685	CLIP-seq
MIRT968058	hsa-miR-3714	CLIP-seq
MIRT968059	hsa-miR-371-5p	CLIP-seq
MIRT968060	hsa-miR-379	CLIP-seq
MIRT968061	hsa-miR-3909	CLIP-seq
MIRT968062	hsa-miR-3914	CLIP-seq
MIRT968063	hsa-miR-3924	CLIP-seq
MIRT968064	hsa-miR-3941	CLIP-seq
MIRT968065	hsa-miR-4275	CLIP-seq
MIRT968066	hsa-miR-4277	CLIP-seq
MIRT968067	hsa-miR-4422	CLIP-seq
MIRT968068	hsa-miR-4436a	CLIP-seq
MIRT968069	hsa-miR-4446-5p	CLIP-seq
MIRT968070	hsa-miR-4451	CLIP-seq
MIRT968071	hsa-miR-4455	CLIP-seq
MIRT968072	hsa-miR-4464	CLIP-seq
MIRT968073	hsa-miR-4476	CLIP-seq
MIRT968074	hsa-miR-4483	CLIP-seq
MIRT968075	hsa-miR-4491	CLIP-seq
MIRT968076	hsa-miR-4501	CLIP-seq
MIRT968077	hsa-miR-4519	CLIP-seq
MIRT968078	hsa-miR-4528	CLIP-seq
MIRT968079	hsa-miR-4533	CLIP-seq
MIRT968080	hsa-miR-4536	CLIP-seq
MIRT968081	hsa-miR-4650-3p	CLIP-seq
MIRT968082	hsa-miR-4657	CLIP-seq
MIRT968083	hsa-miR-4661-3p	CLIP-seq
MIRT968084	hsa-miR-4668-3p	CLIP-seq
MIRT968085	hsa-miR-4698	CLIP-seq
MIRT968086	hsa-miR-4699-3p	CLIP-seq
MIRT968087	hsa-miR-4700-3p	CLIP-seq
MIRT968088	hsa-miR-4716-5p	CLIP-seq
MIRT968089	hsa-miR-4729	CLIP-seq
MIRT968090	hsa-miR-4738-3p	CLIP-seq
MIRT968091	hsa-miR-4742-3p	CLIP-seq
MIRT968092	hsa-miR-4748	CLIP-seq
MIRT968093	hsa-miR-4753-3p	CLIP-seq
MIRT968094	hsa-miR-4755-5p	CLIP-seq
MIRT968095	hsa-miR-4768-5p	CLIP-seq
MIRT968096	hsa-miR-4787-5p	CLIP-seq
MIRT968097	hsa-miR-4800-5p	CLIP-seq
MIRT968098	hsa-miR-498	CLIP-seq
MIRT968099	hsa-miR-501-3p	CLIP-seq
MIRT968100	hsa-miR-502-3p	CLIP-seq
MIRT968101	hsa-miR-505	CLIP-seq
MIRT968102	hsa-miR-513a-5p	CLIP-seq
MIRT968103	hsa-miR-548an	CLIP-seq
MIRT968104	hsa-miR-583	CLIP-seq
MIRT968105	hsa-miR-592	CLIP-seq
MIRT968106	hsa-miR-597	CLIP-seq
MIRT968107	hsa-miR-599	CLIP-seq
MIRT968108	hsa-miR-603	CLIP-seq
MIRT968109	hsa-miR-607	CLIP-seq
MIRT968110	hsa-miR-609	CLIP-seq
MIRT968111	hsa-miR-622	CLIP-seq
MIRT968112	hsa-miR-642a	CLIP-seq
MIRT968113	hsa-miR-875-3p	CLIP-seq
MIRT968114	hsa-miR-876-5p	CLIP-seq
MIRT968115	hsa-miR-888	CLIP-seq
MIRT968116	hsa-miR-1245b-5p	CLIP-seq
MIRT968027	hsa-miR-1252	CLIP-seq
MIRT968117	hsa-miR-1256	CLIP-seq
MIRT968118	hsa-miR-1271	CLIP-seq
MIRT968028	hsa-miR-1273e	CLIP-seq
MIRT968119	hsa-miR-1275	CLIP-seq
MIRT968120	hsa-miR-1279	CLIP-seq
MIRT968029	hsa-miR-1290	CLIP-seq
MIRT968030	hsa-miR-1293	CLIP-seq
MIRT968031	hsa-miR-1299	CLIP-seq
MIRT968032	hsa-miR-1303	CLIP-seq
MIRT968121	hsa-miR-130a	CLIP-seq
MIRT968122	hsa-miR-130b	CLIP-seq
MIRT968034	hsa-miR-137	CLIP-seq
MIRT968123	hsa-miR-138	CLIP-seq
MIRT968124	hsa-miR-144	CLIP-seq
MIRT968125	hsa-miR-182	CLIP-seq
MIRT968126	hsa-miR-1911	CLIP-seq
MIRT968127	hsa-miR-1913	CLIP-seq
MIRT968128	hsa-miR-19a	CLIP-seq
MIRT968129	hsa-miR-19b	CLIP-seq
MIRT968130	hsa-miR-2054	CLIP-seq
MIRT968131	hsa-miR-2115	CLIP-seq
MIRT968036	hsa-miR-299-3p	CLIP-seq
MIRT968132	hsa-miR-301a	CLIP-seq
MIRT968133	hsa-miR-301b	CLIP-seq
MIRT968134	hsa-miR-302a	CLIP-seq
MIRT968135	hsa-miR-302b	CLIP-seq
MIRT968136	hsa-miR-302c	CLIP-seq
MIRT968137	hsa-miR-302d	CLIP-seq
MIRT968138	hsa-miR-302e	CLIP-seq
MIRT968037	hsa-miR-3065-5p	CLIP-seq
MIRT968139	hsa-miR-30a	CLIP-seq
MIRT968140	hsa-miR-30b	CLIP-seq
MIRT968141	hsa-miR-30c	CLIP-seq
MIRT968142	hsa-miR-30d	CLIP-seq
MIRT968143	hsa-miR-30e	CLIP-seq
MIRT968040	hsa-miR-3129-3p	CLIP-seq
MIRT968042	hsa-miR-3138	CLIP-seq
MIRT968144	hsa-miR-3142	CLIP-seq
MIRT968043	hsa-miR-3143	CLIP-seq
MIRT968145	hsa-miR-3156-5p	CLIP-seq
MIRT968146	hsa-miR-3158-3p	CLIP-seq
MIRT968045	hsa-miR-3167	CLIP-seq
MIRT968147	hsa-miR-3171	CLIP-seq
MIRT968148	hsa-miR-3174	CLIP-seq
MIRT968046	hsa-miR-3202	CLIP-seq
MIRT968149	hsa-miR-324-3p	CLIP-seq
MIRT968047	hsa-miR-326	CLIP-seq
MIRT968050	hsa-miR-330-5p	CLIP-seq
MIRT968052	hsa-miR-3529	CLIP-seq
MIRT968150	hsa-miR-3666	CLIP-seq
MIRT968151	hsa-miR-3692	CLIP-seq
MIRT968152	hsa-miR-372	CLIP-seq
MIRT968153	hsa-miR-373	CLIP-seq
MIRT968060	hsa-miR-379	CLIP-seq
MIRT968154	hsa-miR-3907	CLIP-seq
MIRT968155	hsa-miR-3977	CLIP-seq
MIRT968156	hsa-miR-4295	CLIP-seq
MIRT968070	hsa-miR-4451	CLIP-seq
MIRT968157	hsa-miR-4457	CLIP-seq
MIRT968074	hsa-miR-4483	CLIP-seq
MIRT968075	hsa-miR-4491	CLIP-seq
MIRT968158	hsa-miR-4495	CLIP-seq
MIRT968076	hsa-miR-4501	CLIP-seq
MIRT968159	hsa-miR-4525	CLIP-seq
MIRT968079	hsa-miR-4533	CLIP-seq
MIRT968080	hsa-miR-4536	CLIP-seq
MIRT968160	hsa-miR-454	CLIP-seq
MIRT968161	hsa-miR-4633-5p	CLIP-seq
MIRT968162	hsa-miR-4642	CLIP-seq
MIRT968081	hsa-miR-4650-3p	CLIP-seq
MIRT968082	hsa-miR-4657	CLIP-seq
MIRT968083	hsa-miR-4661-3p	CLIP-seq
MIRT968163	hsa-miR-4665-5p	CLIP-seq
MIRT968164	hsa-miR-4694-3p	CLIP-seq
MIRT968165	hsa-miR-4719	CLIP-seq
MIRT968166	hsa-miR-4720-3p	CLIP-seq
MIRT968167	hsa-miR-4721	CLIP-seq
MIRT968168	hsa-miR-4723-5p	CLIP-seq
MIRT968089	hsa-miR-4729	CLIP-seq
MIRT968090	hsa-miR-4738-3p	CLIP-seq
MIRT968169	hsa-miR-4761-5p	CLIP-seq
MIRT968095	hsa-miR-4768-5p	CLIP-seq
MIRT968170	hsa-miR-4778-3p	CLIP-seq
MIRT968097	hsa-miR-4800-5p	CLIP-seq
MIRT968171	hsa-miR-495	CLIP-seq
MIRT968098	hsa-miR-498	CLIP-seq
MIRT968172	hsa-miR-513a-3p	CLIP-seq
MIRT968102	hsa-miR-513a-5p	CLIP-seq
MIRT968173	hsa-miR-513b	CLIP-seq
MIRT968174	hsa-miR-516a-3p	CLIP-seq
MIRT968175	hsa-miR-519a	CLIP-seq
MIRT968176	hsa-miR-519b-3p	CLIP-seq
MIRT968177	hsa-miR-519c-3p	CLIP-seq
MIRT968178	hsa-miR-520a-3p	CLIP-seq
MIRT968179	hsa-miR-520b	CLIP-seq
MIRT968180	hsa-miR-520c-3p	CLIP-seq
MIRT968181	hsa-miR-520d-3p	CLIP-seq
MIRT968182	hsa-miR-520e	CLIP-seq
MIRT968183	hsa-miR-522	CLIP-seq
MIRT968184	hsa-miR-532-5p	CLIP-seq
MIRT968185	hsa-miR-578	CLIP-seq
MIRT968186	hsa-miR-579	CLIP-seq
MIRT968187	hsa-miR-587	CLIP-seq
MIRT968188	hsa-miR-590-3p	CLIP-seq
MIRT968189	hsa-miR-625	CLIP-seq
MIRT968190	hsa-miR-637	CLIP-seq
MIRT968191	hsa-miR-643	CLIP-seq
MIRT968192	hsa-miR-661	CLIP-seq
MIRT968113	hsa-miR-875-3p	CLIP-seq
MIRT968114	hsa-miR-876-5p	CLIP-seq
MIRT968193	hsa-miR-9	CLIP-seq
MIRT968194	hsa-miR-96	CLIP-seq
MIRT968040	hsa-miR-3129-3p	CLIP-seq
MIRT968043	hsa-miR-3143	CLIP-seq
MIRT968089	hsa-miR-4729	CLIP-seq
MIRT1986813	hsa-miR-101	CLIP-seq
MIRT1986814	hsa-miR-1243	CLIP-seq
MIRT1986815	hsa-miR-1251	CLIP-seq
MIRT1986816	hsa-miR-1253	CLIP-seq
MIRT1986817	hsa-miR-1273g	CLIP-seq
MIRT968124	hsa-miR-144	CLIP-seq
MIRT1986818	hsa-miR-146a	CLIP-seq
MIRT1986819	hsa-miR-1976	CLIP-seq
MIRT1986820	hsa-miR-205	CLIP-seq
MIRT1986821	hsa-miR-221	CLIP-seq
MIRT1986822	hsa-miR-222	CLIP-seq
MIRT1986823	hsa-miR-23a	CLIP-seq
MIRT1986824	hsa-miR-23b	CLIP-seq
MIRT1986825	hsa-miR-23c	CLIP-seq
MIRT1986826	hsa-miR-2467-3p	CLIP-seq
MIRT1986827	hsa-miR-302f	CLIP-seq
MIRT968038	hsa-miR-3074-5p	CLIP-seq
MIRT1986828	hsa-miR-3140-5p	CLIP-seq
MIRT968043	hsa-miR-3143	CLIP-seq
MIRT1986829	hsa-miR-3145-3p	CLIP-seq
MIRT1986830	hsa-miR-3153	CLIP-seq
MIRT1986831	hsa-miR-3654	CLIP-seq
MIRT1986832	hsa-miR-3662	CLIP-seq
MIRT1986833	hsa-miR-3678-3p	CLIP-seq
MIRT968059	hsa-miR-371-5p	CLIP-seq
MIRT1986834	hsa-miR-371b-5p	CLIP-seq
MIRT1986835	hsa-miR-377	CLIP-seq
MIRT1986836	hsa-miR-3919	CLIP-seq
MIRT1986837	hsa-miR-4279	CLIP-seq
MIRT1986838	hsa-miR-4282	CLIP-seq
MIRT1986839	hsa-miR-4287	CLIP-seq
MIRT1986840	hsa-miR-4289	CLIP-seq
MIRT1986841	hsa-miR-432	CLIP-seq
MIRT1986842	hsa-miR-433	CLIP-seq
MIRT1986843	hsa-miR-4453	CLIP-seq
MIRT968157	hsa-miR-4457	CLIP-seq
MIRT1986844	hsa-miR-4469	CLIP-seq
MIRT1986845	hsa-miR-4531	CLIP-seq
MIRT1986846	hsa-miR-4538	CLIP-seq
MIRT1986847	hsa-miR-4684-5p	CLIP-seq
MIRT1986848	hsa-miR-4685-3p	CLIP-seq
MIRT968085	hsa-miR-4698	CLIP-seq
MIRT968086	hsa-miR-4699-3p	CLIP-seq
MIRT1986849	hsa-miR-4703-3p	CLIP-seq
MIRT968166	hsa-miR-4720-3p	CLIP-seq
MIRT1986850	hsa-miR-4724-3p	CLIP-seq
MIRT968089	hsa-miR-4729	CLIP-seq
MIRT1986851	hsa-miR-511	CLIP-seq
MIRT1986852	hsa-miR-513c	CLIP-seq
MIRT1986853	hsa-miR-514b-5p	CLIP-seq
MIRT1986854	hsa-miR-548p	CLIP-seq
MIRT1986855	hsa-miR-548v	CLIP-seq
MIRT968112	hsa-miR-642a	CLIP-seq
MIRT1986813	hsa-miR-101	CLIP-seq
MIRT968026	hsa-miR-1246	CLIP-seq
MIRT968027	hsa-miR-1252	CLIP-seq
MIRT2221360	hsa-miR-1255a	CLIP-seq
MIRT2221361	hsa-miR-1255b	CLIP-seq
MIRT968029	hsa-miR-1290	CLIP-seq
MIRT968032	hsa-miR-1303	CLIP-seq
MIRT968121	hsa-miR-130a	CLIP-seq
MIRT968122	hsa-miR-130b	CLIP-seq
MIRT2221362	hsa-miR-1323	CLIP-seq
MIRT968124	hsa-miR-144	CLIP-seq
MIRT968127	hsa-miR-1913	CLIP-seq
MIRT2221363	hsa-miR-193b	CLIP-seq
MIRT968128	hsa-miR-19a	CLIP-seq
MIRT968129	hsa-miR-19b	CLIP-seq
MIRT968132	hsa-miR-301a	CLIP-seq
MIRT968133	hsa-miR-301b	CLIP-seq
MIRT968134	hsa-miR-302a	CLIP-seq
MIRT968135	hsa-miR-302b	CLIP-seq
MIRT968136	hsa-miR-302c	CLIP-seq
MIRT968137	hsa-miR-302d	CLIP-seq
MIRT968138	hsa-miR-302e	CLIP-seq
MIRT2221364	hsa-miR-3125	CLIP-seq
MIRT2221365	hsa-miR-3132	CLIP-seq
MIRT1986830	hsa-miR-3153	CLIP-seq
MIRT2221366	hsa-miR-3154	CLIP-seq
MIRT968045	hsa-miR-3167	CLIP-seq
MIRT2221367	hsa-miR-3170	CLIP-seq
MIRT2221368	hsa-miR-3176	CLIP-seq
MIRT2221369	hsa-miR-3180-5p	CLIP-seq
MIRT2221370	hsa-miR-3189-3p	CLIP-seq
MIRT2221371	hsa-miR-3200-5p	CLIP-seq
MIRT968149	hsa-miR-324-3p	CLIP-seq
MIRT968052	hsa-miR-3529	CLIP-seq
MIRT2221372	hsa-miR-3659	CLIP-seq
MIRT1986832	hsa-miR-3662	CLIP-seq
MIRT968150	hsa-miR-3666	CLIP-seq
MIRT968057	hsa-miR-3685	CLIP-seq
MIRT968059	hsa-miR-371-5p	CLIP-seq
MIRT1986834	hsa-miR-371b-5p	CLIP-seq
MIRT968152	hsa-miR-372	CLIP-seq
MIRT968153	hsa-miR-373	CLIP-seq
MIRT1986835	hsa-miR-377	CLIP-seq
MIRT968060	hsa-miR-379	CLIP-seq
MIRT2221373	hsa-miR-384	CLIP-seq
MIRT2221374	hsa-miR-3916	CLIP-seq
MIRT2221375	hsa-miR-3922-3p	CLIP-seq
MIRT2221376	hsa-miR-4255	CLIP-seq
MIRT1986838	hsa-miR-4282	CLIP-seq
MIRT968156	hsa-miR-4295	CLIP-seq
MIRT2221377	hsa-miR-4302	CLIP-seq
MIRT968158	hsa-miR-4495	CLIP-seq
MIRT968079	hsa-miR-4533	CLIP-seq
MIRT968160	hsa-miR-454	CLIP-seq
MIRT2221378	hsa-miR-4640-5p	CLIP-seq
MIRT2221379	hsa-miR-4646-5p	CLIP-seq
MIRT968081	hsa-miR-4650-3p	CLIP-seq
MIRT2221380	hsa-miR-4652-3p	CLIP-seq
MIRT2221381	hsa-miR-4658	CLIP-seq
MIRT2221382	hsa-miR-4682	CLIP-seq
MIRT968085	hsa-miR-4698	CLIP-seq
MIRT968086	hsa-miR-4699-3p	CLIP-seq
MIRT2221383	hsa-miR-4699-5p	CLIP-seq
MIRT968166	hsa-miR-4720-3p	CLIP-seq
MIRT1986850	hsa-miR-4724-3p	CLIP-seq
MIRT2221384	hsa-miR-4726-5p	CLIP-seq
MIRT968089	hsa-miR-4729	CLIP-seq
MIRT968091	hsa-miR-4742-3p	CLIP-seq
MIRT2221385	hsa-miR-4747-5p	CLIP-seq
MIRT2221386	hsa-miR-4762-3p	CLIP-seq
MIRT2221387	hsa-miR-4766-5p	CLIP-seq
MIRT2221388	hsa-miR-496	CLIP-seq
MIRT968172	hsa-miR-513a-3p	CLIP-seq
MIRT968175	hsa-miR-519a	CLIP-seq
MIRT968176	hsa-miR-519b-3p	CLIP-seq
MIRT968177	hsa-miR-519c-3p	CLIP-seq
MIRT968178	hsa-miR-520a-3p	CLIP-seq
MIRT2221389	hsa-miR-520a-5p	CLIP-seq
MIRT968179	hsa-miR-520b	CLIP-seq
MIRT968180	hsa-miR-520c-3p	CLIP-seq
MIRT968181	hsa-miR-520d-3p	CLIP-seq
MIRT968182	hsa-miR-520e	CLIP-seq
MIRT2221390	hsa-miR-525-5p	CLIP-seq
MIRT2221391	hsa-miR-548l	CLIP-seq
MIRT2221392	hsa-miR-548o	CLIP-seq
MIRT1986854	hsa-miR-548p	CLIP-seq
MIRT2221393	hsa-miR-574-5p	CLIP-seq
MIRT968186	hsa-miR-579	CLIP-seq
MIRT2221394	hsa-miR-606	CLIP-seq
MIRT2221395	hsa-miR-646	CLIP-seq
MIRT968114	hsa-miR-876-5p	CLIP-seq
MIRT2221396	hsa-miR-892b	CLIP-seq
MIRT2221397	hsa-miR-936	CLIP-seq
MIRT968040	hsa-miR-3129-3p	CLIP-seq
MIRT968043	hsa-miR-3143	CLIP-seq
MIRT968053	hsa-miR-3613-3p	CLIP-seq
MIRT968058	hsa-miR-3714	CLIP-seq
MIRT1986838	hsa-miR-4282	CLIP-seq
MIRT968088	hsa-miR-4716-5p	CLIP-seq
MIRT2448916	hsa-miR-4731-3p	CLIP-seq
MIRT2448917	hsa-miR-4801	CLIP-seq
MIRT968103	hsa-miR-548an	CLIP-seq
MIRT968187	hsa-miR-587	CLIP-seq
MIRT968109	hsa-miR-607	CLIP-seq
MIRT968088	hsa-miR-4716-5p	CLIP-seq
MIRT2448916	hsa-miR-4731-3p	CLIP-seq
MIRT2448917	hsa-miR-4801	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
WWP1	Repression	19561640

Show/Hide all(65)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IMP	15534001
GO:0001755	Process	Neural crest cell migration	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	TAS	15534001
GO:0004713	Function	Protein tyrosine kinase activity	IDA	18334220
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA	21873635
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IDA	18334220
GO:0005154	Function	Epidermal growth factor receptor binding	IBA	21873635
GO:0005154	Function	Epidermal growth factor receptor binding	IPI	8617750
GO:0005515	Function	Protein binding	IPI	9135143, 9419975, 10572067, 10725395, 11867753, 15282549, 15345710, 16273093, 16767099, 17360433, 18334649, 19561640, 20227043, 20858735, 21203579, 22939624, 24557338, 25283809, 28988771, 30083275
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IDA	15534001
GO:0005654	Component	Nucleoplasm	TAS
GO:0005739	Component	Mitochondrion	IDA	16778220
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007165	Process	Signal transduction	IDA	10572067
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IDA	10353604, 18334220
GO:0007275	Process	Multicellular organism development	IBA	21873635
GO:0007399	Process	Nervous system development	ISS
GO:0007416	Process	Synapse assembly	IEA
GO:0007507	Process	Heart development	ISS
GO:0007595	Process	Lactation	IMP	15534001
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	8617750, 9135143
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	17120616
GO:0009880	Process	Embryonic pattern specification	ISS
GO:0009925	Component	Basal plasma membrane	IBA	21873635
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	12646923
GO:0016477	Process	Cell migration	IDA	9135143
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	18334220
GO:0021551	Process	Central nervous system morphogenesis	ISS
GO:0021889	Process	Olfactory bulb interneuron differentiation	ISS
GO:0030334	Process	Regulation of cell migration	ISS
GO:0033674	Process	Positive regulation of kinase activity	IBA	21873635
GO:0038128	Process	ERBB2 signaling pathway	TAS
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IMP	16837552
GO:0042803	Function	Protein homodimerization activity	IPI	18334220
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IMP	16778220
GO:0045165	Process	Cell fate commitment	IEA
GO:0045211	Component	Postsynaptic membrane	ISS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	15534001
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IMP	15534001
GO:0046777	Process	Protein autophosphorylation	IDA	18334220
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	ISS
GO:0060644	Process	Mammary gland epithelial cell differentiation	ISS
GO:0060749	Process	Mammary gland alveolus development	ISS
GO:0061026	Process	Cardiac muscle tissue regeneration	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	10348342
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:0099061	Component	Integral component of postsynaptic density membrane	IEA
GO:2000010	Process	Positive regulation of protein localization to cell surface	IEA
GO:2000145	Process	Regulation of cell motility	TAS
GO:2001223	Process	Negative regulation of neuron migration	IEA

MIM	HGNC	e!Ensembl
600543	3432	ENSG00000178568

Protein

UniProt ID

Q15303

Protein name

Receptor tyrosine-protein kinase erbB-4 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-4) (Tyrosine kinase-type cell surface receptor HER4) (p180erbB4) [Cleaved into: ERBB4 intracellular domain (4ICD) (E4ICD) (s80HER4)]

Protein function

Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins and EGF family members and regulates development of the heart, the central nervous system and the mammary gland, gene transcription, cell proliferation

PDB

2AHX , 2L2T , 2LCX , 2R4B , 3BBT , 3BBW , 3BCE , 3U2P , 3U7U , 3U9U , 8U4I , 8U4J , 8U4K , 8U4L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01030	Recep_L_domain	55 → 167	Receptor L domain	Repeat
PF00757	Furin-like	176 → 335	Furin-like cysteine rich region	Domain
PF01030	Recep_L_domain	358 → 478	Receptor L domain	Repeat
PF14843	GF_recep_IV	502 → 634	Growth factor receptor domain IV	Domain
PF07714	PK_Tyr_Ser-Thr	718 → 974	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at highest levels in brain, heart, kidney, in addition to skeletal muscle, parathyroid, cerebellum, pituitary, spleen, testis and breast. Lower levels in thymus, lung, salivary gland, and pancreas. Isoform JM-A CYT-1 and isof

Sequence

MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYD
GEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVP
YRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERS
PRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAED
EYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV

Sequence length

1308

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway ErbB signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Amyotrophic lateral sclerosis Proteoglycans in cancer		Signaling by ERBB2 Signaling by ERBB4 SHC1 events in ERBB2 signaling PI3K events in ERBB4 signaling SHC1 events in ERBB4 signaling Nuclear signaling by ERBB4 Downregulation of ERBB4 signaling PIP3 activates AKT signaling GRB2 events in ERBB2 signaling PI3K events in ERBB2 signaling Constitutive Signaling by Aberrant PI3K in Cancer RAF/MAP kinase cascade ERBB2 Regulates Cell Motility PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling ERBB2 Activates PTK6 Signaling Downregulation of ERBB2 signaling Estrogen-dependent gene expression Signaling by ERBB2 KD Mutants Signaling by ERBB2 TMD/JMD mutants

Show/Hide Causal Diseases (13)

Disease term	Disease name	dbSNP ID	References
Causal
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis, AMYOTROPHIC LATERAL SCLEROSIS 6 (disorder), AMYOTROPHIC LATERAL SCLEROSIS 1, AUTOSOMAL RECESSIVE, AMYOTROPHIC LATERAL SCLEROSIS 19, Amyotrophic lateral sclerosis	rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733 View all (171 more)	24119685, 24529757
Atrial fibrillation	Atrial Fibrillation	rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557 View all (6 more)	30061737, 29892015
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	22843504
Breast adenocarcinoma	Breast adenocarcinoma	rs28934874, rs112445441, rs121913279, rs121913286, rs104886003, rs121434592
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	22452962
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	22452962
Colorectal cancer	Adenocarcinoma of large intestine	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)
Gallbladder cancer	Malignant neoplasm of gallbladder	rs121913530, rs377767360, rs121913529, rs730882029, rs730882005, rs786202799, rs876659802, rs1057519718, rs764146326	24997986
Lateral sclerosis	AMYOTROPHIC LATERAL SCLEROSIS 1, Amyotrophic Lateral Sclerosis, Sporadic	rs386134181, rs386134176, rs386134174, rs386134184, rs386134178, rs1693780539, rs1574698048	24529757
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Lung carcinoma	Squamous cell carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)
Melanoma	melanoma, Cutaneous Melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	19718025
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	23628989, 23891727, 23752247, 25142529

Show/Hide Unknown Diseases (17)

Disease term	Disease name	Evidence	References	Source
Unknown
Asthma	Asthma		24824216	ClinVar, GWAS
Mental depression	Depressive disorder, Major Depressive Disorder		29942085, 29662059	ClinVar
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation		30061737, 29892015	ClinVar
Amyotrophic Lateral Sclerosis	amyotrophic lateral sclerosis type 19, amyotrophic lateral sclerosis			GenCC
Neuroticism	Neuroticism			GWAS
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome			GWAS
Atrial Fibrillation	Atrial Fibrillation			GWAS
Gout	Gout			GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA
Systemic lupus erythematosus	Systemic lupus erythematosus			GWAS
Diabetes	Diabetes			GWAS
Ovarian cancer	Ovarian cancer	Conditional KD of IL6 in the OCCA xenograft model delays tumor growth		GWAS, CBGDA
Gastroesophageal Reflux Disease	Gastroesophageal Reflux Disease			GWAS
Metabolic Syndrome	Metabolic Syndrome			GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587		GWAS, CBGDA
Coronary artery disease	Coronary artery disease			GWAS
Insomnia	Insomnia			GWAS

Show/Hide Text Mining Associations (165)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Kidney Injury	Associate	34886903
Adenocarcinoma	Associate	26315110, 26317919, 31407221
Adenocarcinoma of Lung	Associate	17487277, 18948947, 26254096, 26824984
Adenomatous Polyposis Coli	Associate	36264285
Adrenocortical Carcinoma	Associate	25078331
Aicardi Syndrome	Associate	26011570
Alzheimer Disease	Associate	22486522
Alzheimer Disease	Inhibit	37533101
Amyotrophic Lateral Sclerosis	Associate	24119685
Amyotrophic lateral sclerosis 1	Associate	24119685
Aortic Aneurysm Familial Abdominal 1	Associate	22115776
Aortic Coarctation	Associate	21290564
Aortic Valve Stenosis	Associate	21290564
Asthma	Associate	24152222, 29973587
Astrocytoma	Associate	19017278
Autism Spectrum Disorder	Associate	22952857
Bipolar Disorder	Associate	21232925, 21637803, 25744101, 30120408
Brain Neoplasms	Associate	19017278, 23224376
Breast Neoplasms	Associate	11390655, 15084248, 15735025, 16251361, 16417655, 16428439, 16606438, 16778220, 17201160, 17299391, 17465220, 17505063, 17661082, 17903305, 18182100 View all (24 more)
Calcinosis Cutis	Stimulate	23681745
Carcinogenesis	Associate	21407808, 23492901
Carcinoid Tumor	Associate	38237798
Carcinoma	Associate	23917679
Carcinoma Acinar Cell	Associate	27713419
Carcinoma Basal Cell	Associate	33928395
Carcinoma Embryonal	Associate	32999426
Carcinoma Hepatocellular	Associate	22294845
Carcinoma in Situ	Associate	23927961
Carcinoma Large Cell	Associate	30793508
Carcinoma Merkel Cell	Associate	28359267
Carcinoma Neuroendocrine	Associate	36653904
Carcinoma Non Small Cell Lung	Associate	17094398, 23154546, 34106605, 34620079
Carcinoma Ovarian Epithelial	Inhibit	30948450
Carcinoma Papillary	Associate	23917679
Carcinoma Renal Cell	Associate	21253009, 22554477, 29353061, 29635281
Carcinoma Squamous Cell	Associate	17465227, 26479420, 36780540
Cardiomyopathies	Associate	30224945
Cardiomyopathy infantile histiocytoid	Associate	27282351
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	16397033
Chromosome 1q21.1 Deletion Syndrome 1.35 Mb	Associate	19017278
Cognition Disorders	Associate	21232925, 33603162
Colonic Neoplasms	Associate	16507107, 34794066
Colonic Neoplasms	Inhibit	36442170
Colorectal Neoplasms	Associate	16507107, 25335735, 25366420, 25416285, 26797410, 28629469, 29945573, 32319604, 34794066, 35213358, 35505597
Coronary Artery Disease	Stimulate	12869389
Coronavirus Infections	Associate	33968364
COVID 19	Associate	38575325
Death	Associate	22115776
Depressive Disorder	Associate	29973587
Depressive Disorder Major	Associate	30120408
Dermatitis Exfoliative	Associate	33603162
Diabetes Gestational	Associate	38149095
Diabetes Mellitus Type 2	Associate	23369358
Drug Related Side Effects and Adverse Reactions	Associate	22415601, 22990204
Endocrine System Diseases	Associate	22854050, 37460683
Endodermal Sinus Tumor	Associate	32999426
Endometrial Neoplasms	Associate	20664599
Ependymoma	Associate	25859842
Epidermolysis bullosa with pyloric atresia	Associate	19017278
Epilepsies Myoclonic	Associate	18854870
Epilepsy	Associate	28273943, 33603162
Esophageal Neoplasms	Associate	25538945, 28467773, 30115035
Esophageal Squamous Cell Carcinoma	Associate	24438167, 30975989
Fatty Liver	Inhibit	39735994
Fatty Liver Alcoholic	Inhibit	39735994
Fibrocystic Breast Disease	Associate	27713419
Frontotemporal Dementia	Associate	22115776
Gallbladder Neoplasms	Associate	38092180
Gastrointestinal Neoplasms	Associate	36264285
Germinoma	Associate	32999426
Glioblastoma	Inhibit	20467331
Glioblastoma	Associate	29342193
Glioma	Associate	15812817, 16097449, 33892666
Guillain Barre Syndrome	Inhibit	37221406
Heart Diseases	Associate	30224945
Heart Failure	Associate	31960146
Hemorrhage	Associate	36264285
Hepatoblastoma	Associate	27910913
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	20603612, 36442170
Hirschsprung Disease	Associate	29483666
Huntington Disease	Associate	33049985
Hyperandrogenism	Associate	32289280
Hypertension Pulmonary	Associate	31960146
Hypogonadism	Associate	30098700
Hypoplastic Left Heart Syndrome	Associate	21290564
Idiopathic Pulmonary Fibrosis	Stimulate	35130915
Infertility	Associate	32289280
Inflammation	Associate	24944161, 30224945
Inflammatory Breast Neoplasms	Associate	30086764
Intellectual Disability	Associate	33603162
Iron Overload	Inhibit	31960146
Kidney Failure Chronic	Associate	31960146
Leukemia Lymphoma Adult T Cell	Associate	34147695
Leukoplakia	Associate	23492901
Leukoplakia Oral	Associate	23492901
Liver Neoplasms	Associate	35426263
Lung Neoplasms	Associate	31182981
Lymphatic Metastasis	Stimulate	32319604
Lymphatic Metastasis	Associate	34106605
Lymphoma T Cell Peripheral	Associate	34147695
Medulloblastoma	Associate	19017278
Melanoma	Associate	19800573, 20404484, 23237222, 24258993, 24628946, 24709886, 28356599, 33378376, 37160315
Melanoma Cutaneous Malignant	Associate	27640074
Mental Disorders	Associate	21232925, 21832192, 25744101, 38285192
Mitochondrial Diseases	Associate	16778220
Mood Disorders	Associate	21637803, 30120408
Multiple Myeloma	Associate	14576062
Nasal Polyps	Associate	27285994
Neoplasm Metastasis	Associate	17201160, 23917679, 24091566, 26254096, 27270314, 27910913
Neoplasm Metastasis	Stimulate	23681745
Neoplasms	Associate	11692142, 11696537, 15976335, 16251361, 16507107, 16685269, 17465220, 17638867, 17661082, 19624808, 19800573, 20035613, 20071783, 20404484, 20420713 View all (35 more)
Neoplasms	Inhibit	16778220, 18948947, 20467331, 20603612, 24728052, 25492965, 29342193, 29353061, 36442170, 37047493
Neoplasms Squamous Cell	Associate	25538945
Neuralgia	Associate	29141020
Neuroblastoma	Associate	22415601
Neuroectodermal Tumors	Associate	37160315
Neuroendocrine Tumors	Associate	28042953
Neuroinflammatory Diseases	Stimulate	32690068
Nonsyndromic Holoprosencephaly	Associate	33603162
Obesity	Stimulate	36411648
Obesity Morbid	Associate	31852448
Oligomenorrhea	Associate	32289280
Oropharyngeal Neoplasms	Associate	26949921
Osteosarcoma	Associate	16007579
Ovarian Neoplasms	Associate	24901400, 28178720, 30485824, 33036254
Pancreatic Intraductal Neoplasms	Associate	27282351
Pancreatic Neoplasms	Associate	19304440, 21110957, 27871278
Pancreatitis	Associate	21110957
Parkinson Disease	Associate	27640074
Penile Neoplasms	Associate	28751665
Peritoneal Neoplasms	Associate	26811494
Personality Disorders	Associate	23681745
Pleural Effusion	Stimulate	26254096
Polycystic Ovary Syndrome	Associate	26416764, 28068351, 28195137, 32289280, 35157673
Pre Eclampsia	Associate	24944161
Precancerous Conditions	Inhibit	24318637
Prolactinoma	Associate	24287797
Prostatic Neoplasms	Associate	16397033, 17922460, 18282083, 23661456, 25472581
Prostatitis	Associate	16934755
Psychomotor Disorders	Associate	18854870
Psychotic Disorders	Associate	22115776
Pterygium	Associate	33299863
Sarcoma	Associate	29801054
Sarcoma Ewing	Associate	17409416, 23681745, 28542597
Schizophrenia	Associate	17579610, 18243664, 18854870, 20713722, 21232925, 21637803, 21832192, 21876540, 22115776, 22952857, 23752247, 25744101, 26337038, 30120408, 32690068
Sepsis	Associate	30224945
Severe Acute Respiratory Syndrome	Associate	33968364
smoker's inclusion bodies	Associate	23752247
Squamous Cell Carcinoma of Head and Neck	Associate	14595263, 28984303, 31109699
Status Asthmaticus	Associate	29973587
Stomach Neoplasms	Associate	22606006, 25583476, 26811494, 27270314, 33021020, 33900127
Stomach Neoplasms	Inhibit	24728052
Substance Related Disorders	Associate	23752247
Teratoma	Associate	37160315
Tertiary Lymphoid Structures	Associate	38151289
Thyroid Cancer Papillary	Associate	25922907
Thyroid Neoplasms	Associate	23917679
Tobacco Use Disorder	Associate	23752247
Trigeminal Neuralgia	Associate	28273943
Triple Negative Breast Neoplasms	Associate	24505496, 26907936
Urethral Neoplasms	Associate	18006009
Urinary Bladder Neoplasms	Associate	15583696, 18006009
Urinary Bladder Neurogenic	Associate	38285192
Uterine Cervical Neoplasms	Associate	23927961
Ventricular Outflow Obstruction Left	Associate	21290564

ERBB4 (erb-b2 receptor tyrosine kinase 4)