Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2056
Gene name Gene Name - the full gene name approved by the HGNC.	Erythropoietin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EPO
Synonyms (NCBI Gene) Gene synonyms aliases	DBAL, ECYT5, EP, MVCD2
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The encoded protein is mainly synthesized in the kidney, secreted into the blood plasma, and binds to the erythropoietin receptor to promote red blood cell product

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1617640	C>A,G,T	Risk-factor	Upstream transcript variant
rs1358275550	G>A	Pathogenic	Coding sequence variant, missense variant
rs1554393458	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1554393463	G>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022112	hsa-miR-125b-5p	Other	20194440
MIRT022112	hsa-miR-125b-5p	Luciferase reporter assay	24165569
MIRT022112	hsa-miR-125b-5p	Luciferase reporter assay	24165569
MIRT022112	hsa-miR-125b-5p	Luciferase reporter assay	24165569
MIRT022112	hsa-miR-125b-5p	Luciferase reporter assay	24165569
MIRT022112	hsa-miR-125b-5p	Luciferase reporter assay	24165569
MIRT022112	hsa-miR-125b-5p	Luciferase reporter assay	24165569
MIRT022112	hsa-miR-125b-5p	Luciferase reporter assay	24165569
MIRT022112	hsa-miR-125b-5p	Luciferase reporter assay	24165569
MIRT755730	hsa-miR-144-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Immunohistochemistry (IHC), Flow cytometry	36763178
MIRT967163	hsa-miR-125a-5p	CLIP-seq
MIRT967164	hsa-miR-125b	CLIP-seq
MIRT967165	hsa-miR-1323	CLIP-seq
MIRT967166	hsa-miR-3185	CLIP-seq
MIRT967167	hsa-miR-338-3p	CLIP-seq
MIRT967168	hsa-miR-4319	CLIP-seq
MIRT967169	hsa-miR-4421	CLIP-seq
MIRT967170	hsa-miR-4535	CLIP-seq
MIRT967171	hsa-miR-4682	CLIP-seq
MIRT967172	hsa-miR-4709-3p	CLIP-seq
MIRT967173	hsa-miR-4731-3p	CLIP-seq
MIRT967174	hsa-miR-4732-3p	CLIP-seq
MIRT967175	hsa-miR-4776-5p	CLIP-seq
MIRT967176	hsa-miR-4793-5p	CLIP-seq
MIRT967177	hsa-miR-4801	CLIP-seq
MIRT967178	hsa-miR-548o	CLIP-seq
MIRT967179	hsa-miR-670	CLIP-seq
MIRT967180	hsa-miR-760	CLIP-seq
MIRT967181	hsa-miR-890	CLIP-seq
MIRT1986500	hsa-miR-3176	CLIP-seq
MIRT1986501	hsa-miR-326	CLIP-seq
MIRT1986502	hsa-miR-330-5p	CLIP-seq
MIRT1986503	hsa-miR-3655	CLIP-seq
MIRT1986504	hsa-miR-378	CLIP-seq
MIRT1986505	hsa-miR-378b	CLIP-seq
MIRT1986506	hsa-miR-378c	CLIP-seq
MIRT1986507	hsa-miR-378d	CLIP-seq
MIRT1986508	hsa-miR-378e	CLIP-seq
MIRT1986509	hsa-miR-378f	CLIP-seq
MIRT1986510	hsa-miR-378h	CLIP-seq
MIRT1986511	hsa-miR-378i	CLIP-seq
MIRT1986512	hsa-miR-3922-3p	CLIP-seq
MIRT1986513	hsa-miR-422a	CLIP-seq
MIRT1986514	hsa-miR-4326	CLIP-seq
MIRT1986515	hsa-miR-4520a-3p	CLIP-seq
MIRT1986516	hsa-miR-4638-3p	CLIP-seq
MIRT1986517	hsa-miR-578	CLIP-seq
MIRT2221039	hsa-miR-1285	CLIP-seq
MIRT2221040	hsa-miR-2115	CLIP-seq
MIRT2221041	hsa-miR-296-5p	CLIP-seq
MIRT2221042	hsa-miR-3074-5p	CLIP-seq
MIRT2221043	hsa-miR-3187-5p	CLIP-seq
MIRT2221044	hsa-miR-3194-3p	CLIP-seq
MIRT2221045	hsa-miR-3194-5p	CLIP-seq
MIRT1986501	hsa-miR-326	CLIP-seq
MIRT1986502	hsa-miR-330-5p	CLIP-seq
MIRT2221046	hsa-miR-370	CLIP-seq
MIRT2221047	hsa-miR-378g	CLIP-seq
MIRT2221048	hsa-miR-3943	CLIP-seq
MIRT2221049	hsa-miR-4486	CLIP-seq
MIRT2221050	hsa-miR-516a-3p	CLIP-seq
MIRT2221051	hsa-miR-612	CLIP-seq

Transcription factors

Show/Hide all(13)

Transcription factor	Regulation	Reference
ARNT	Activation	8663540
EP300	Activation	20368990
GATA1	Activation	16471262
GATA1	Repression	8677751
GATA2	Repression	8677751
GATA3	Repression	8677751
HIF1A	Activation	8089148;8663540
HIF1A	Unknown	16281953
NCOA1	Activation	20368990
NCOA3	Activation	20368990
SMAD3	Unknown	14741200
SMAD4	Unknown	14741200
SP1	Activation	14741200

Show/Hide all(68)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	16497104
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	9774108, 28283061
GO:0005128	Function	Erythropoietin receptor binding	IBA
GO:0005128	Function	Erythropoietin receptor binding	IEA
GO:0005128	Function	Erythropoietin receptor binding	IMP	28283061
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IDA	9722506
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	9774108, 26481148, 29997244, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	32989016
GO:0005615	Component	Extracellular space	IDA	14569084
GO:0005615	Component	Extracellular space	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006950	Process	Response to stress	IEA
GO:0006953	Process	Acute-phase response	IEA
GO:0007165	Process	Signal transduction	NAS	3838366
GO:0007566	Process	Embryo implantation	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008015	Process	Blood circulation	NAS	3838366
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	9722506
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009651	Process	Response to salt stress	IEA
GO:0009986	Component	Cell surface	IDA	14569084
GO:0010523	Process	Negative regulation of calcium ion transport into cytosol	IDA	14569084
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0030218	Process	Erythrocyte differentiation	IBA
GO:0030218	Process	Erythrocyte differentiation	IDA	15084469
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IMP	28283061
GO:0030295	Function	Protein kinase activator activity	IBA
GO:0030295	Function	Protein kinase activator activity	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033028	Process	Myeloid cell apoptotic process	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0033189	Process	Response to vitamin A	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0038162	Process	Erythropoietin-mediated signaling pathway	IBA
GO:0038162	Process	Erythropoietin-mediated signaling pathway	IDA	2163696, 9657743
GO:0038162	Process	Erythropoietin-mediated signaling pathway	IDA	9722506, 9774108
GO:0038162	Process	Erythropoietin-mediated signaling pathway	IMP	28283061
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042541	Process	Hemoglobin biosynthetic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	11781573, 34518685
GO:0043249	Process	Erythrocyte maturation	IEA
GO:0043627	Process	Response to estrogen	IEA
GO:0044297	Component	Cell body	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	9722506
GO:0046579	Process	Positive regulation of Ras protein signal transduction	IDA	9722506
GO:0048678	Process	Response to axon injury	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0055093	Process	Response to hyperoxia	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070555	Process	Response to interleukin-1	IEA
GO:0071474	Process	Cellular hyperosmotic response	IDA	14569084
GO:0071548	Process	Response to dexamethasone	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IBA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	9722506
GO:1902219	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress	IDA	14569084
GO:1902251	Process	Negative regulation of erythrocyte apoptotic process	IDA	14569084

MIM	HGNC	e!Ensembl
133170	3415	ENSG00000130427

Protein

UniProt ID

P01588

Protein name

Erythropoietin (Epoetin)

Protein function

Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass (PubMed:28283061). Binds to EPOR leading to EPOR dimerization and JAK2 activation th

PDB

1BUY , 1CN4 , 1EER

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00758	EPO_TPO	31 → 192	Erythropoietin/thrombopoietin	Domain

Tissue specificity

TISSUE SPECIFICITY: Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals. {ECO:0000269|PubMed:3865178}.

Sequence

MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC
SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL
KLYTGEACRTGDR

Sequence length

193

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction HIF-1 signaling pathway Hormone signaling Efferocytosis PI3K-Akt signaling pathway JAK-STAT signaling pathway Hematopoietic cell lineage Pathways in cancer		Regulation of gene expression by Hypoxia-inducible Factor Erythropoietin activates Phosphoinositide-3-kinase (PI3K) Erythropoietin activates RAS

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Anemia	diamond-blackfan anemia-like	rs1358275550	N/A
Erythrocytosis	erythrocytosis, familial, 5	rs1554393458, rs1554393463	N/A

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Polycythemia	autosomal dominant secondary polycythemia	N/A	N/A	GenCC
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (224)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abnormalities Drug Induced	Associate	9292543
Abortion Spontaneous	Inhibit	22135724
Acute Lung Injury	Associate	19164355
AIDS Dementia Complex	Inhibit	1709368
alpha Thalassemia	Inhibit	35802781
Altitude Sickness	Associate	26625252, 31617751
Alzheimer Disease	Associate	22388478
Amyotrophic Lateral Sclerosis	Associate	25595151
Anemia	Associate	11090055, 11675943, 15496172, 16304357, 16407130, 20019408, 20473273, 21406725, 25227310, 26922982, 28283061, 29768025, 306845, 31630548, 32027948 View all (5 more)
Anemia	Inhibit	11844847, 12846752, 14626572, 15247979, 15798000, 15967106, 16648896, 16888788, 1824252, 18383321, 18596367, 19536148, 19646258, 21098876, 21449784 View all (21 more)
Anemia Aplastic	Associate	1375845, 33521754
Anemia Aplastic	Inhibit	8580564
Anemia Diamond Blackfan	Associate	15238419, 1653276, 16619478, 32798645, 3498522, 8608241, 8630424
Anemia Dyserythropoietic Congenital	Associate	36927785
Anemia Hemolytic	Inhibit	17107348, 18075299, 22955851, 32912025, 34051741
Anemia Hemolytic	Associate	24120591
Anemia Hemolytic Autoimmune	Associate	18626921
Anemia Sickle Cell	Associate	12714517, 24599433
Aortic Dissection	Associate	39604843
Arthritis Rheumatoid	Inhibit	1824252
Asthma	Associate	27434124
Astrocytoma	Associate	15367334
Atherosclerosis	Associate	16482103
Atrial myxoma familial	Associate	23839603
Atrophy	Inhibit	15247979
beta Thalassemia	Associate	16304357, 26376749, 37672319
Brain Ischemia	Associate	24055514
Brain Neoplasms	Associate	14563949
Breast Neoplasms	Associate	12209679, 15160341, 17597020, 18596367, 20164027, 22955851, 24100272, 24165569, 32912025, 34949656
Budd Chiari Syndrome	Stimulate	25452296
Burns	Associate	32842148
Carcinogenesis	Associate	12759237, 14965363, 16627979, 22025882, 30915348
Carcinoma Hepatocellular	Associate	10628941, 11920461, 12239177, 17394495, 19828693, 23830978, 26097591, 26624507, 27774607, 2825172, 28421649, 28739744, 34634301, 36345952, 7524823, 7528138, 9236155 View all (2 more)
Carcinoma Merkel Cell	Associate	17201175
Carcinoma Non Small Cell Lung	Associate	27494133, 31752873
Carcinoma Pancreatic Ductal	Associate	21829709
Carcinoma Renal Cell	Associate	10628941, 11986208, 16627979, 16740034, 17696210, 18075299, 19407488, 2162339, 23780896, 27468719, 36966432, 40332447
Carcinoma Renal Cell	Stimulate	26575329
Carcinoma Squamous Cell	Associate	12759237, 30915348, 39575407
Cardio Renal Syndrome	Associate	17177647
Cardio Renal Syndrome	Inhibit	30103295
Cardiomyopathies	Inhibit	19958860
Cardiovascular Diseases	Associate	30103295
Carotid Stenosis	Associate	23584809
Cataract	Associate	34384366
Cerebrovascular Disorders	Stimulate	16482103
Charcot Marie Tooth Disease Recessive Intermediate A	Inhibit	35422072
Chromosome 7 monosomy	Inhibit	8580564
Chronic Disease	Associate	1373333, 16434484
Chronic Limb Threatening Ischemia	Associate	24055514
Colitis Ulcerative	Associate	23825635
Colorectal Neoplasms	Associate	19846965, 23825635, 24497137
Congenital Bone Marrow Failure Syndromes	Associate	23713742
Congenital heart block	Associate	18050204
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	12393546, 24599433
COVID 19	Associate	34185793, 35092718, 36611805
Cyclic neutropenia	Stimulate	30834265
Cystic Fibrosis	Associate	2891140, 3462737
Cysts	Associate	32546701
Cytokine Release Syndrome	Associate	1373333
Death	Associate	17938574, 26034358
Diabetes Mellitus	Associate	23106921, 33158076
Diabetes Mellitus Type 2	Associate	31316151, 33599115, 35677638
Diabetic Retinopathy	Associate	21067572, 27190272, 31799636, 35677638
Diabetic Retinopathy	Stimulate	23106921
Drug Hypersensitivity	Associate	10498627, 1954391, 26859458, 27389715, 9359528
Drug Hypersensitivity	Stimulate	15676208
Duane Retraction Syndrome	Associate	35677638
Dyskeratosis Congenita	Inhibit	9163594
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	16684963, 17852451
Eczema	Associate	27434124
Endometrial Neoplasms	Associate	15160341
Enterocolitis Neutropenic	Associate	1692489
Ependymoma	Associate	14563949
Epstein Barr Virus Infections	Inhibit	27338098
Erythrocytosis Familial 2	Stimulate	12393546
Erythrocytosis Familial 2	Associate	16210343, 21933857
Esophageal Neoplasms	Associate	39575407
Fetal Growth Retardation	Associate	30089456
Fibrosis	Inhibit	28535509
Fibrosis	Associate	31630548
Friedreich Ataxia	Associate	23922695
Genetic Diseases Inborn	Associate	12393546
Glaucoma Angle Closure	Stimulate	34384366
Glioma	Associate	18754880
Glycogen Storage Disease XII	Associate	17579185
Head and Neck Neoplasms	Associate	15967106
Heart Diseases	Inhibit	19690392
Heart Failure	Associate	20019408, 20427614, 26721912
Hemangioblastoma	Associate	16163267, 27748427, 36966432, 9787178
Hemangiosarcoma	Associate	15015593
Hematologic Diseases	Inhibit	1709368
Hematologic Neoplasms	Inhibit	1709368
Hepatitis C Chronic	Associate	25227310
Hepatitis E	Associate	8081000
Hepatoblastoma	Associate	14563949
Hip Injuries	Stimulate	31881381
HIV Infections	Associate	26599070
Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	Associate	24599433, 30677867
Hypertension	Stimulate	10792608, 11675943, 21690481, 32027948
Hypertension	Associate	11675943, 8510379
Hypoxia	Associate	10354503, 11494119, 12393546, 12482504, 12759237, 14563949, 14726398, 15743794, 18050204, 18283323, 19187226, 20164027, 21933857, 22172637, 23509317 View all (17 more)
Hypoxia	Stimulate	10358107, 11090055, 11971899, 12070140, 12209679, 12239177, 12761217, 12844285, 1373333, 15160341, 16681756, 19208626, 1985693, 20026900, 21036916 View all (15 more)
Hypoxia	Inhibit	28535509
Hypoxia Brain	Stimulate	10866824, 11971899, 14600132, 18174379, 19208626, 21406725, 21566342, 2162339, 8917528, 9027728
Hypoxia Brain	Associate	12209679, 12759237, 15015593, 15160341, 15598882, 21595915, 28535509, 34384366, 7980410
Immunodeficiency without anhidrotic ectodermal dysplasia	Inhibit	11844847
Immunologic Deficiency Syndromes	Inhibit	15247979
Inflammation	Inhibit	10029160, 22957013, 35422072
Inflammation	Associate	34355696
Iron Deficiencies	Associate	31170159
Iron Overload	Inhibit	26243982
Iron Overload	Associate	31838956
Ischemia	Associate	35422072
Ketosis	Stimulate	37062892
Kidney Diseases	Inhibit	11675943, 17107348, 35422072
Kidney Diseases	Associate	2297568, 26205024
Kidney Failure Chronic	Inhibit	11844847, 12846752
Kidney Failure Chronic	Associate	15798000, 24188099, 28697735
Kidney Neoplasms	Associate	10628941, 11986208, 2297568
Kidney Neoplasms	Stimulate	16627979
Klinefelter Syndrome	Associate	28369266
Laryngeal Neoplasms	Associate	33545970, 36397112
Leiomyoma	Associate	11328280, 30554729
Leishmaniasis Visceral	Associate	9531339
Leukemia	Associate	16413387, 1653276, 1834251, 24761846, 27840303, 3498522, 37543610, 7537740, 8329702, 9657745
Leukemia Erythroblastic Acute	Associate	3264194, 7685196, 7919379, 8608241, 9573013
Leukemia Erythroblastic Acute	Stimulate	7687159
Leukemia Megakaryoblastic Acute	Associate	9573295
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	6583283, 7690436, 9576192
Leukemia Myeloid Acute	Associate	2460160, 3264194
Leukemia Myeloid Acute	Inhibit	9798667
Leydig Cell Tumor	Associate	31630548
Liver Diseases	Associate	26034358
Liver Neoplasms	Associate	17394495
Lung Neoplasms	Associate	27494133
Lupus Erythematosus Systemic	Associate	18626921
Lymphangioleiomyomatosis	Associate	21036916
Lymphatic Metastasis	Associate	22025882
Macular Edema	Associate	20664492
Malaria	Associate	19930602
Malaria Cerebral	Associate	19930602, 30060095
Mammary Neoplasms Animal	Associate	12209679
Melanoma	Associate	15743794, 19536148, 20804540
Mesothelioma Malignant	Associate	16740034
Metabolic Syndrome	Stimulate	23016887
Metabolic Syndrome	Associate	25915923
Multiple Myeloma	Inhibit	17107348
Myelodysplastic Syndromes	Associate	10460607, 11122147, 11861273, 15287942, 18383321, 20823131, 21078205, 29079596, 31508719, 31838956, 32027948, 8580564, 9057652
Myelodysplastic Syndromes	Inhibit	24399021, 38206689, 8943864
Myocardial Infarction	Stimulate	11986208, 19690392
Myocardial Ischemia	Associate	19958860
Myoma	Associate	11328280
Necrosis	Associate	12209679
Neoplasm Metastasis	Associate	20164027
Neoplasms	Associate	11090055, 11328280, 11986208, 12209679, 12393546, 12759237, 14563949, 14647149, 15015593, 15160341, 15967106, 16627979, 16681756, 17298169, 17394495 View all (23 more)
Neoplasms	Stimulate	19536148, 26575329, 32235007
Neoplasms	Inhibit	32912025
Nerve Degeneration	Inhibit	22388478
Nervous System Diseases	Associate	23029019
Neural Tube Defects	Associate	10460607, 8695798
Neural Tube Defects	Stimulate	8580564
Neuroblastoma	Associate	10087335, 12239177, 14563949, 17394500, 17647284, 34556815, 35887076
Neurodegenerative Diseases	Associate	22388478, 23029019, 37511274
Non Muscle Invasive Bladder Neoplasms	Associate	27626805
Obesity	Associate	31525610
Obesity Abdominal	Stimulate	23016887
Optic Neuropathy Ischemic	Associate	26205024
Pancreatic Neoplasms	Associate	21829709
Periodontitis	Associate	29207066
Peripheral Arterial Disease	Associate	33158076
Pigmentary Disorder Reticulate with Systemic Manifestations	Associate	35677638
Polycythemia	Associate	10628941, 11328280, 11986208, 12393546, 14521712, 16687917, 17579185, 17696210, 18055983, 18378852, 18793248, 1954391, 19735488, 21497288, 21723416 View all (14 more)
Polycythemia	Stimulate	21933857
Polycythemia primary familial and congenital	Associate	10498627, 12844285, 23716564, 36966432, 7306703, 7795221, 9292543, 9488636, 9649565
Polycythemia primary familial and congenital	Stimulate	1954391
Polycythemia Vera	Associate	12829587, 15102479, 15676208, 17389763, 17852451, 18616871, 19815050, 21497288, 23341442, 23839603, 25040297, 25452296, 30677867, 30948488, 31525610 View all (10 more)
Polycythemia Vera	Inhibit	23839603, 27614230, 33593422, 39262095
Pregnancy in Diabetics	Associate	22135724
Pregnancy Tubal	Associate	30176889
Primary Myelofibrosis	Associate	16532437
Prostatic Neoplasms	Associate	19567780, 31417010
Prostatic Neoplasms Castration Resistant	Associate	31417010
Psychological Distress	Associate	23713742
Pulmonary Arterial Hypertension	Associate	21258008
Pulmonary Disease Chronic Obstructive	Associate	37796693
Pyruvate Kinase Deficiency of Red Cells	Associate	36927785
Red Cell Aplasia Pure	Stimulate	11844847
Red Cell Aplasia Pure	Associate	18626921, 26599070
Renal Insufficiency	Associate	22955851, 25915923
Renal Insufficiency Chronic	Associate	16482103, 21690481, 23584809, 31924810, 32027948, 37086098
Renal Insufficiency Chronic	Inhibit	18547996, 23337206, 35611811
Renal Tubular Transport Inborn Errors	Inhibit	35422072
Reperfusion Injury	Associate	26205024
Respiratory Insufficiency	Associate	27774607
Retinal Dysplasia	Associate	12759237
Retinal Vein Occlusion	Stimulate	20664492
Retinopathy of Prematurity	Associate	40084286
Rett Syndrome	Inhibit	34355696
Rhabdomyosarcoma	Associate	26412593
Sarcoma Ewing	Associate	17695539
Sepsis	Associate	26034358
Sickle Cell Trait	Associate	37533140
Somatostatinoma	Associate	33049075
Spherocytosis Hereditary	Associate	36927785
Squamous Cell Carcinoma of Head and Neck	Associate	15967106, 18802791, 33466212
Squamous Intraepithelial Lesions	Associate	30915348
Stomach Neoplasms	Associate	22025882
Symptom Flare Up	Inhibit	27614230
Syndrome	Associate	34129019
Thalassemia	Associate	16304357
Thrombocytopenia	Inhibit	8580564
Thrombosis	Stimulate	15247979
Thrombosis	Associate	37435906
Transfusion Reaction	Associate	30834265
Tricuspid Valve Insufficiency	Stimulate	21900080
Vascular Diseases	Stimulate	23584809
Venous Thrombosis	Stimulate	15247979
Vitamin D Deficiency	Associate	37123164
von Hippel Lindau Disease	Associate	12393546, 21933857, 27748427
von Hippel Lindau Disease	Stimulate	16627979
Wilms Tumor	Associate	14563949
Wounds and Injuries	Stimulate	31207479
Wounds Nonpenetrating	Associate	29768025

EPO (erythropoietin)