DIPK2A (divergent protein kinase domain 2A)

Gene

• Entrez ID: 205428
• Gene name: Divergent protein kinase domain 2A
• Gene symbol: DIPK2A
• Synonyms (NCBI Gene): C3orf58, DIA1, GoPro49, HASF
• Chromosome: 3
• Chromosome location: 3q24

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	18651652
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	23784961
GO:0005794	Component	Golgi apparatus	IEA
GO:0030126	Component	COPI vesicle coat	IBA
GO:0030126	Component	COPI vesicle coat	IDA	18651652
GO:0030137	Component	COPI-coated vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	IDA	24269490
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	IEA
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23784961
GO:0060038	Process	Cardiac muscle cell proliferation	IBA
GO:0060038	Process	Cardiac muscle cell proliferation	IDA	23784961
GO:1900020	Process	Positive regulation of protein kinase C activity	IGI	24269490

Other IDs

• MIM: 612200
• HGNC: 28490
• e!Ensembl: ENSG00000181744

Protein

• UniProt ID: Q8NDZ4
• Protein name: Divergent protein kinase domain 2A (Deleted in autism protein 1) (Golgi Protein of 49 kDa) (GoPro49) (Hypoxia and AKT-induced stem cell factor) (HASF)
• Protein function: May play a role in cardiomyocyte proliferation through paracrine signaling and activation of the PPI3K-AKT-CDK7 signaling cascade.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12260	PIP49_C	206 → 405	Protein-kinase domain of FAM69	Family

• Sequence:

  MWRLVPPKLGRLSRSLKLAALGSLLVLMVLHSPSLLASWQRNELTDRRFLQLNKCPACFG
  TSWCRRFLNGQVVFEAWGRLRLLDFLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQ
  LDQSICKRATGRPRCDLLQAMPRTEFARLNGDVRLLTPEAVEGWSDLVHCPSQRLLDRLV
  RRYAETKDSGSFLLRNLKDSERMQLLLTLAFNPEPLVLQSFPSDEGWPFAKYLGACGRMV
  AVNYVGEELWSYFNAPWEKRVDLAWQLMEIAEQLTNNDFEFALYLLDVSFDNFAVGPRDG
  KVIIVDAENVLVADKRLIRQNKPENWDVWYESKFDDCDKEACLSFSKEILCARATVDHNY
  YAVCQNLLSRHATWRGTSGGLLHDPPSEIAKDGRLEALLDECANPKKRYGRFQAAKELRE
  YLAQLSNNVR

• Sequence length: 430