EPHA8 (EPH receptor A8)

Gene

• Entrez ID: 2046
• Gene name: EPH receptor A8
• Gene symbol: EPHA8
• Synonyms (NCBI Gene): EEK, EK3, HEK3
• Chromosome: 1
• Chromosome location: 1p36.12
• Summary: This gene encodes a member of the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typ

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT734812	hsa-miR-10a-3p	Microarray	33530159
MIRT966625	hsa-miR-1298	CLIP-seq
MIRT966626	hsa-miR-378g	CLIP-seq
MIRT966627	hsa-miR-4731-5p	CLIP-seq
MIRT966628	hsa-miR-764	CLIP-seq
MIRT966629	hsa-miR-1249	CLIP-seq
MIRT966630	hsa-miR-3150a-3p	CLIP-seq
MIRT966631	hsa-miR-3175	CLIP-seq
MIRT966632	hsa-miR-3184	CLIP-seq
MIRT966633	hsa-miR-361-3p	CLIP-seq
MIRT966634	hsa-miR-3675-5p	CLIP-seq
MIRT966635	hsa-miR-423-5p	CLIP-seq
MIRT966636	hsa-miR-4284	CLIP-seq
MIRT966637	hsa-miR-4302	CLIP-seq
MIRT966638	hsa-miR-4417	CLIP-seq
MIRT966639	hsa-miR-4437	CLIP-seq
MIRT966640	hsa-miR-4476	CLIP-seq
MIRT966641	hsa-miR-450b-5p	CLIP-seq
MIRT966642	hsa-miR-4514	CLIP-seq
MIRT966643	hsa-miR-4645-5p	CLIP-seq
MIRT966644	hsa-miR-4651	CLIP-seq
MIRT966645	hsa-miR-4673	CLIP-seq
MIRT966646	hsa-miR-4674	CLIP-seq
MIRT966647	hsa-miR-4685-5p	CLIP-seq
MIRT966648	hsa-miR-4692	CLIP-seq
MIRT966649	hsa-miR-4697-3p	CLIP-seq
MIRT966650	hsa-miR-4716-5p	CLIP-seq
MIRT966651	hsa-miR-4723-5p	CLIP-seq
MIRT966652	hsa-miR-4728-5p	CLIP-seq
MIRT966653	hsa-miR-4738-5p	CLIP-seq
MIRT966654	hsa-miR-4794	CLIP-seq
MIRT966655	hsa-miR-486-3p	CLIP-seq
MIRT966656	hsa-miR-507	CLIP-seq
MIRT966657	hsa-miR-541	CLIP-seq
MIRT966658	hsa-miR-557	CLIP-seq
MIRT966659	hsa-miR-587	CLIP-seq
MIRT966660	hsa-miR-591	CLIP-seq
MIRT966661	hsa-miR-608	CLIP-seq
MIRT966662	hsa-miR-617	CLIP-seq
MIRT966663	hsa-miR-654-5p	CLIP-seq
MIRT966664	hsa-miR-939	CLIP-seq
MIRT966633	hsa-miR-361-3p	CLIP-seq
MIRT1986302	hsa-miR-4419a	CLIP-seq
MIRT1986303	hsa-miR-4436b-3p	CLIP-seq
MIRT1986304	hsa-miR-4459	CLIP-seq
MIRT1986305	hsa-miR-4510	CLIP-seq
MIRT1986306	hsa-miR-4661-3p	CLIP-seq
MIRT1986307	hsa-miR-4722-5p	CLIP-seq
MIRT1986308	hsa-miR-4779	CLIP-seq
MIRT966642	hsa-miR-4514	CLIP-seq
MIRT966643	hsa-miR-4645-5p	CLIP-seq
MIRT966645	hsa-miR-4673	CLIP-seq
MIRT966648	hsa-miR-4692	CLIP-seq
MIRT2387487	hsa-miR-218	CLIP-seq
MIRT2387488	hsa-miR-455-5p	CLIP-seq
MIRT2387489	hsa-miR-4709-3p	CLIP-seq
MIRT2387490	hsa-miR-636	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005003	Function	Ephrin receptor activity	IEA
GO:0005003	Function	Ephrin receptor activity	ISS
GO:0005004	Function	GPI-linked ephrin receptor activity	IEA
GO:0005004	Function	GPI-linked ephrin receptor activity	ISS
GO:0005005	Function	Transmembrane-ephrin receptor activity	IBA
GO:0005524	Function	ATP binding	IEA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006929	Process	Substrate-dependent cell migration	IEA
GO:0006929	Process	Substrate-dependent cell migration	ISS
GO:0007155	Process	Cell adhesion	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007411	Process	Axon guidance	IEA
GO:0007411	Process	Axon guidance	ISS
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016322	Process	Neuron remodeling	IEA
GO:0016322	Process	Neuron remodeling	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0019838	Function	Growth factor binding	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030155	Process	Regulation of cell adhesion	ISS
GO:0030425	Component	Dendrite	IBA
GO:0031175	Process	Neuron projection development	IEA
GO:0031175	Process	Neuron projection development	ISS
GO:0031901	Component	Early endosome membrane	IEA
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IEA
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0071372	Process	Cellular response to follicle-stimulating hormone stimulus	IEA

Other IDs

• MIM: 176945
• HGNC: 3391
• e!Ensembl: ENSG00000070886

Protein

• UniProt ID: P29322
• Protein name: Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK)
• Protein function: Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is
• PDB: 1UCV, 1X5L, 3KUL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01404	Ephrin_lbd	32 → 204	Ephrin receptor ligand binding domain	Domain
  PF00041	fn3	330 → 424	Fibronectin type III domain	Domain
  PF00041	fn3	438 → 524	Fibronectin type III domain	Domain
  PF14575	EphA2_TM	542 → 632	Ephrin type-A receptor 2 transmembrane domain	Domain
  PF07714	PK_Tyr_Ser-Thr	635 → 892	Protein tyrosine and serine/threonine kinase	Domain
  PF00536	SAM_1	932 → 992	SAM domain (Sterile alpha motif)	Domain

• Sequence:

  MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
  DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
  TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRG
  FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
  DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
  APAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDI
  TYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
  LSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEK
  DKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDT
  RTIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHP
  PGKLPEPQFYAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQR
  DVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGS
  LDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFG
  LSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYW
  NMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPE
  SLRATATVSRCPPPAFVRSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLG
  MVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL

• Sequence length: 1005

Pathways

KEGG:

Axon guidance

Reactome:

EPH-Ephrin signaling
EPHA-mediated growth cone collapse
EPH-ephrin mediated repulsion of cells

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
High myopia	Uncertain significance	rs149877319	RCV000785719

Associations from Text Mining
Disease Name	Relationship Type	References
Anemia Sickle Cell	Associate	11698299
Breast Neoplasms	Inhibit	19151749
Breast Neoplasms	Associate	19435818
Bruton type agammaglobulinemia	Associate	8013627
Carcinoma Ovarian Epithelial	Stimulate	26989075
Carcinoma Pancreatic Ductal	Associate	33213062
Carcinoma Renal Cell	Associate	27590381
Cardiomyopathy infantile histiocytoid	Associate	27282351
Esophageal Squamous Cell Carcinoma	Associate	35216506
Gastrointestinal Stromal Tumors	Associate	23479771
Glioma	Associate	25683004
Glut1 Deficiency Syndrome	Associate	17250680
Hematologic Diseases	Associate	31023863
Hematologic Neoplasms	Associate	25092868
Hepatitis B	Associate	22390814
Leukemia	Associate	23860658
Leukemia Lymphocytic Chronic B Cell	Associate	11126203, 7620163
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	2440021, 3276362
Leukemia Myeloid Acute	Associate	28727840
Medulloblastoma	Associate	25258252
Multiple Myeloma	Associate	33530159
Neoplasm Metastasis	Associate	19435818, 26989075
Neoplasms	Inhibit	19151749
Neoplasms	Associate	23447535, 23860658, 2440021, 35269562
Nervous System Diseases	Associate	27582484
Pancreatic Intraductal Neoplasms	Associate	27282351
Pancreatic Neoplasms	Associate	33213062
Philadelphia Chromosome	Associate	3276362
Squamous Cell Carcinoma of Head and Neck	Associate	30300334
Status Asthmaticus	Stimulate	36313228