Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2045
Gene name Gene Name - the full gene name approved by the HGNC.	EPH receptor A7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EPHA7
Synonyms (NCBI Gene) Gene synonyms aliases	EHK-3, EHK3, EK11, HEK11
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q16.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically ha

Show/Hide all(113)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026092	hsa-miR-196a-5p	Sequencing	20371350
MIRT028172	hsa-miR-93-5p	Sequencing	20371350
MIRT049149	hsa-miR-92a-3p	CLASH	23622248
MIRT045990	hsa-miR-125b-5p	CLASH	23622248
MIRT043415	hsa-miR-331-3p	CLASH	23622248
MIRT039849	hsa-miR-615-3p	CLASH	23622248
MIRT037905	hsa-miR-455-3p	CLASH	23622248
MIRT548308	hsa-miR-200a-3p	PAR-CLIP	21572407
MIRT548307	hsa-miR-141-3p	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT318833	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT548306	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT548305	hsa-miR-577	PAR-CLIP	21572407
MIRT548304	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT548303	hsa-miR-4330	PAR-CLIP	21572407
MIRT548302	hsa-miR-3934-3p	PAR-CLIP	21572407
MIRT548301	hsa-miR-4760-5p	PAR-CLIP	21572407
MIRT548299	hsa-miR-8061	PAR-CLIP	21572407
MIRT548308	hsa-miR-200a-3p	PAR-CLIP	21572407
MIRT548307	hsa-miR-141-3p	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT318833	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT548306	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT548305	hsa-miR-577	PAR-CLIP	21572407
MIRT548304	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT548303	hsa-miR-4330	PAR-CLIP	21572407
MIRT548302	hsa-miR-3934-3p	PAR-CLIP	21572407
MIRT548300	hsa-miR-4775	PAR-CLIP	21572407
MIRT548301	hsa-miR-4760-5p	PAR-CLIP	21572407
MIRT548299	hsa-miR-8061	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT734801	hsa-miR-651-3p	RNA-seq	31540331
MIRT736191	hsa-miR-18a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33236144
MIRT548308	hsa-miR-200a-3p	PAR-CLIP	21572407
MIRT548307	hsa-miR-141-3p	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT318833	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT548306	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT548305	hsa-miR-577	PAR-CLIP	21572407
MIRT548304	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT548303	hsa-miR-4330	PAR-CLIP	21572407
MIRT548302	hsa-miR-3934-3p	PAR-CLIP	21572407
MIRT548301	hsa-miR-4760-5p	PAR-CLIP	21572407
MIRT548299	hsa-miR-8061	PAR-CLIP	21572407
MIRT548308	hsa-miR-200a-3p	PAR-CLIP	21572407
MIRT548307	hsa-miR-141-3p	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT318833	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT548306	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT548305	hsa-miR-577	PAR-CLIP	21572407
MIRT548304	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT548303	hsa-miR-4330	PAR-CLIP	21572407
MIRT548302	hsa-miR-3934-3p	PAR-CLIP	21572407
MIRT548300	hsa-miR-4775	PAR-CLIP	21572407
MIRT548301	hsa-miR-4760-5p	PAR-CLIP	21572407
MIRT548299	hsa-miR-8061	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT966614	hsa-miR-1299	CLIP-seq
MIRT966615	hsa-miR-203	CLIP-seq
MIRT966616	hsa-miR-4444	CLIP-seq
MIRT966617	hsa-miR-4477a	CLIP-seq
MIRT966618	hsa-miR-4705	CLIP-seq
MIRT966619	hsa-miR-4753-3p	CLIP-seq
MIRT966620	hsa-miR-4782-5p	CLIP-seq
MIRT966621	hsa-miR-496	CLIP-seq
MIRT966622	hsa-miR-516b	CLIP-seq
MIRT966623	hsa-miR-7	CLIP-seq
MIRT966624	hsa-miR-875-3p	CLIP-seq
MIRT1986292	hsa-miR-3074-3p	CLIP-seq
MIRT1986293	hsa-miR-3671	CLIP-seq
MIRT1986294	hsa-miR-412	CLIP-seq
MIRT1986295	hsa-miR-4255	CLIP-seq
MIRT1986296	hsa-miR-4302	CLIP-seq
MIRT1986297	hsa-miR-4310	CLIP-seq
MIRT1986298	hsa-miR-4711-5p	CLIP-seq
MIRT1986299	hsa-miR-4719	CLIP-seq
MIRT1986300	hsa-miR-513b	CLIP-seq
MIRT1986301	hsa-miR-578	CLIP-seq
MIRT2220875	hsa-miR-103a	CLIP-seq
MIRT2220876	hsa-miR-107	CLIP-seq
MIRT2220877	hsa-miR-125a-5p	CLIP-seq
MIRT2220878	hsa-miR-125b	CLIP-seq
MIRT2220879	hsa-miR-1278	CLIP-seq
MIRT2220880	hsa-miR-30a	CLIP-seq
MIRT2220881	hsa-miR-30b	CLIP-seq
MIRT2220882	hsa-miR-30c	CLIP-seq
MIRT2220883	hsa-miR-30d	CLIP-seq
MIRT2220884	hsa-miR-30e	CLIP-seq
MIRT2220885	hsa-miR-3168	CLIP-seq
MIRT2220886	hsa-miR-320e	CLIP-seq
MIRT2220887	hsa-miR-325	CLIP-seq
MIRT2220888	hsa-miR-3545-3p	CLIP-seq
MIRT2220889	hsa-miR-3617	CLIP-seq
MIRT2220890	hsa-miR-3663-3p	CLIP-seq
MIRT2220891	hsa-miR-4266	CLIP-seq
MIRT2220892	hsa-miR-4277	CLIP-seq
MIRT2220893	hsa-miR-4311	CLIP-seq
MIRT2220894	hsa-miR-4319	CLIP-seq
MIRT2220895	hsa-miR-4490	CLIP-seq
MIRT2220896	hsa-miR-4503	CLIP-seq
MIRT2220897	hsa-miR-4724-5p	CLIP-seq
MIRT2220898	hsa-miR-4735-5p	CLIP-seq
MIRT2220899	hsa-miR-4795-3p	CLIP-seq
MIRT2220900	hsa-miR-4796-5p	CLIP-seq
MIRT2220901	hsa-miR-512-3p	CLIP-seq
MIRT2220902	hsa-miR-628-3p	CLIP-seq
MIRT2220903	hsa-miR-641	CLIP-seq
MIRT2524581	hsa-miR-1229	CLIP-seq
MIRT2524582	hsa-miR-342-3p	CLIP-seq
MIRT1986299	hsa-miR-4719	CLIP-seq
MIRT2524583	hsa-miR-4753-5p	CLIP-seq

Show/Hide all(63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	ISS
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005003	Function	Ephrin receptor activity	IEA
GO:0005004	Function	GPI-linked ephrin receptor activity	IEA
GO:0005004	Function	GPI-linked ephrin receptor activity	ISS
GO:0005005	Function	Transmembrane-ephrin receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	22036564, 33961781, 35384245
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16862074
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	ISS
GO:0008046	Function	Axon guidance receptor activity	IEA
GO:0008046	Function	Axon guidance receptor activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016310	Process	Phosphorylation	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0019838	Function	Growth factor binding	IEA
GO:0022407	Process	Regulation of cell-cell adhesion	IEA
GO:0022407	Process	Regulation of cell-cell adhesion	ISS
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0031290	Process	Retinal ganglion cell axon guidance	IEA
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031952	Process	Regulation of protein autophosphorylation	ISS
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045499	Function	Chemorepellent activity	IEA
GO:0045499	Function	Chemorepellent activity	ISS
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IDA	17726105
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048671	Process	Negative regulation of collateral sprouting	IEA
GO:0048755	Process	Branching morphogenesis of a nerve	IEA
GO:0048755	Process	Branching morphogenesis of a nerve	ISS
GO:0050730	Process	Regulation of peptidyl-tyrosine phosphorylation	IDA	17726105
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050919	Process	Negative chemotaxis	ISS
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051964	Process	Negative regulation of synapse assembly	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IDA	17726105
GO:0072178	Process	Nephric duct morphogenesis	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099175	Process	Regulation of postsynapse organization	IEA
GO:0099634	Component	Postsynaptic specialization membrane	IEA

MIM	HGNC	e!Ensembl
602190	3390	ENSG00000135333

Protein

UniProt ID

Q15375

Protein name

Ephrin type-A receptor 7 (EC 2.7.10.1) (EPH homology kinase 3) (EHK-3) (EPH-like kinase 11) (EK11) (hEK11)

Protein function

Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is

PDB

2REI , 3DKO , 3H8M , 3NRU , 7EEC , 7EED , 7EEF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01404	Ephrin_lbd	33 → 205	Ephrin receptor ligand binding domain	Domain
PF00041	fn3	333 → 427	Fibronectin type III domain	Domain
PF00041	fn3	444 → 527	Fibronectin type III domain	Domain
PF14575	EphA2_TM	557 → 630	Ephrin type-A receptor 2 transmembrane domain	Domain
PF07714	PK_Tyr_Ser-Thr	633 → 890	Protein tyrosine and serine/threonine kinase	Domain
PF07647	SAM_2	920 → 985	SAM domain (Sterile alpha motif)	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed.

Sequence

MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
FSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
NDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATG
KMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHF
KFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDV
AVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALD
AFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLS
RVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDM
SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSL
KTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTI
EDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV

Sequence length

998

Interactions

View interactions

	KEGG		Reactome
	Axon guidance		EPH-Ephrin signaling EPHA-mediated growth cone collapse EPH-ephrin mediated repulsion of cells

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Insomnia	Insomnia	N/A	N/A	GWAS
Ischemic Stroke	Ischemic stroke	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Restless Legs Syndrome	Restless legs syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (37)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Autism Spectrum Disorder	Associate	35390284
Autistic Disorder	Associate	29904178
Breast Neoplasms	Associate	21124932, 27195705, 27566654, 33977106
Carcinogenesis	Associate	22496620, 35103233
Carcinoma Basal Cell	Inhibit	35103233
Carcinoma Merkel Cell	Associate	36736454
Carcinoma Non Small Cell Lung	Associate	35798829
Carcinoma Pancreatic Ductal	Associate	19949912
Carcinoma Squamous Cell	Associate	32843430, 39694330
Cleft Palate	Associate	34382870
Colorectal Neoplasms	Associate	20085586
Death	Associate	27195705
Developmental Disabilities	Associate	29904178
Glioblastoma	Associate	18366728
Hereditary Breast and Ovarian Cancer Syndrome	Associate	21124932, 27566654
Hodgkin Disease	Associate	21454882
Inflammation	Stimulate	24022400
Laryngeal Neoplasms	Associate	25968442
Leukemia Myeloid Acute	Associate	17726105
Lymphatic Metastasis	Inhibit	24022400
Lymphoma B Cell	Associate	21454882
Lymphoma Mantle Cell	Associate	21454882
Melanoma	Associate	33236144
Multiple Sclerosis	Associate	15779235
Neoplasms	Associate	21124932, 30670742, 33977106
Neoplasms	Inhibit	35103233
Osteosarcoma	Associate	28604772
Ovarian Neoplasms	Associate	26261572, 28611294
Pancreatic Neoplasms	Associate	19949912
Phyllodes Tumor	Associate	34399808
Primary cortisol resistance	Associate	22496620
Prostatic Neoplasms	Associate	16042785
Squamous Cell Carcinoma of Head and Neck	Associate	24022400, 25612142, 25968442
Stomach Neoplasms	Associate	26769141
Thyroid Hormone Resistance Syndrome	Associate	27195705
Triple Negative Breast Neoplasms	Associate	34396843
Uterine Cervical Neoplasms	Associate	35681118

EPHA7 (EPH receptor A7)