Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
203859
Gene name Gene Name - the full gene name approved by the HGNC.
Anoctamin 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ANO5
Synonyms (NCBI Gene) Gene synonyms aliases
GDD1, LGMD2L, LGMDR12, TMEM16E
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p14.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the anoctamin family of transmembrane proteins. The encoded protein is likely a calcium activated chloride channel. Mutations in this gene have been associated with gnathodiaphyseal dysplasia. Alternatively spliced transcript
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs34994927 G>A,C Likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs119103234 T>C,G Not-provided, pathogenic Coding sequence variant, missense variant
rs137854521 ->A Likely-pathogenic, pathogenic-likely-pathogenic, pathogenic Coding sequence variant, frameshift variant
rs137854523 G>T Likely-pathogenic, pathogenic Coding sequence variant, missense variant
rs137854524 C>G Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT441220 hsa-miR-432-5p HITS-CLIP 24374217
MIRT441220 hsa-miR-432-5p HITS-CLIP 24374217
MIRT785718 hsa-miR-140-5p CLIP-seq
MIRT785719 hsa-miR-203 CLIP-seq
MIRT785720 hsa-miR-23a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001778 Process Plasma membrane repair IMP 33496727
GO:0005229 Function Intracellularly calcium-gated chloride channel activity IDA 22075693
GO:0005229 Function Intracellularly calcium-gated chloride channel activity IDA 22946059
GO:0005254 Function Chloride channel activity IBA
GO:0005254 Function Chloride channel activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608662 27337 ENSG00000171714
Protein
UniProt ID Q75V66
Protein name Anoctamin-5 (Gnathodiaphyseal dysplasia 1 protein) (Transmembrane protein 16E)
Protein function Plays a role in plasma membrane repair in a process involving annexins (PubMed:33496727). Does not exhibit calcium-activated chloride channel (CaCC) activity. {ECO:0000269|PubMed:20056604, ECO:0000269|PubMed:23047743, ECO:0000269|PubMed:33496727
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16178 Anoct_dimer 72 289 Dimerisation domain of Ca+-activated chloride-channel, anoctamin Family
PF04547 Anoctamin 292 868 Calcium-activated chloride channel Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain, heart, kidney, lung, and skeletal muscle. Weakly expressed in bone marrow, fetal liver, placenta, spleen, thymus, osteoblasts and periodontal ligament cells. {ECO:0000269|PubMed:15067359, ECO:0000269|PubMed:1
Sequence
MGDPDLLEVLAEEGEKVNKHIDYSFQMSEQSLSSRETSFLINEETMPAKRFNLFLRRRLM
FQKNQQSKDSIFFRDGIRQIDFVLSYVDDVKKDAELKAERRKEFETNLRKTGLELEIEDK
RDSEDGRTYFVKIHAPWEVLVTYAEVLGIKMPIKESDIPRPKHTPISYVLGPVRLPLSVK
YPHPEYFTAQFSRHRQELFLIEDQATFFPSSSRNRIVYYILSRCPFGIEDGKKRFGIERL
LNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNWARFSYFYKEQPL
DLIKNYYGEKI
GIYFVFLGFYTEMLFFAAVVGLACFIYGLLSMEHNTSSTEICDPEIGGQMIMCPLCDQVC
DYWRLNSTCLASKFSHLFDNESTVFFAIFMGIWVTLFLEFWKQRQARLEYEWDLVDFEEE
QQQLQLRPEFEAMCKHRKLNAVTKEMEPYMPLYTRIPWYFLSGATVTLWMSLVVTSMVAV
IVYRLSVFATFASFMESDASLKQVKSFLTPQITTSLTGSCLNFIVILILNFFYEKISAWI
TKMEIPRTYQEYESSLTLKMFLFQFVNFYSSCFYVAFFKGKFVGYPGKYTYLFNEWRSEE
CDPGGCLIELTTQLTIIMTGKQIFGNIKEAIYPLALNWWRRRKARTNSEKLYSRWEQDHD
LESFGPLGLFYEYLETVTQFGFVTLFVASFPLAPLLALINNIVEIRVDAWKLTTQYRRTV
ASKAHSIGVWQDILYGMAVLSVATNAFIVAFTSDIIPRLVYYYAYSTNATQPMTGYVNNS
LSVFLIADFPNHTAPSEKRDFITCRYRDYRYPPDDENKYFHNMQFWHVLAAKMTFIIVME
HVVFLVKFLLAWMIPDVPKDVVERIKRE
KLMTIKILHDFELNKLKENLGINSNEFAKHVM
IEENKAQLAKSTL
Sequence length 913
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Efferocytosis   Stimuli-sensing channels
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Gnathodiaphyseal Dysplasia gnathodiaphyseal dysplasia rs1554929292, rs1335126943, rs1590266513, rs119103234, rs397514736, rs1057518855 N/A
Limb-girdle muscular dystrophy Autosomal recessive limb-girdle muscular dystrophy type 2L, Autosomal recessive limb-girdle muscular dystrophy rs754889480, rs137854526, rs878854367, rs1403946332, rs137854527, rs142073798, rs1380525804, rs137854523, rs794727158, rs1168346560, rs1590300702, rs188150039, rs137854529, rs1233836740, rs797044667
View all (20 more)
N/A
Miyoshi Muscular Dystrophy miyoshi muscular dystrophy 3 rs137854521, rs886043172, rs137854529, rs281865464, rs281865480, rs201725369 N/A
Muscular dystrophy muscular dystrophy rs368970223 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Mental retardation intellectual disability N/A N/A ClinVar
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atelosteogenesis type 2 Associate 28176803
Bone Diseases Associate 27216912, 29175271
Bone Diseases Metabolic Associate 29175271
Breech Presentation Associate 25891276
Bundle Branch Block Associate 33567613
Cardiomyopathy Hypertrophic Associate 37510237
Cardiomyopathy Right Ventricular Dilated Associate 33567613
Distal Myopathies Associate 20692837, 37510237
Dysferlinopathy Associate 21186264
Femoral Fractures Associate 29175271