Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
203328
Gene name Gene Name - the full gene name approved by the HGNC.
Sushi domain containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SUSD3
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q22.31
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017039 hsa-miR-335-5p Microarray 18185580
MIRT1404047 hsa-miR-1297 CLIP-seq
MIRT1404048 hsa-miR-140-5p CLIP-seq
MIRT1404049 hsa-miR-199a-3p CLIP-seq
MIRT1404050 hsa-miR-199b-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 24413080
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616429 28391 ENSG00000157303
Protein
UniProt ID Q96L08
Protein name Sushi domain-containing protein 3
Protein function May play a role in breast tumorigenesis by promoting estrogen-dependent cell proliferation, cell-cell interactions and migration.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00084 Sushi 32 91 Sushi repeat (SCR repeat) Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in estrogen receptor-positive breast tumors. {ECO:0000269|PubMed:24413080}.
Sequence
MRWAAATLRGKARPRGRAGVTTPAPGNRTGTCAKLRLPPQATFQVLRGNGASVGTVLMFR
CPSNHQMVGSGLLTCTWKGSIAEWSSGSPVC
KLVPPHETFGFKVAVIASIVSCAIILLMS
MAFLTCCLLKCVKKSKRRRSNRSAQLWSQLKDEDLETVQAAYLGLKHFNKPVSGPSQAHD
NHSFTTDHGESTSKLASVTRSVDKDPGIPRALSLSGSSSSPQAQVMVHMANPRQPLPASG
LATGMPQQPAAYALG
Sequence length 255
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atrial Fibrillation Associate 37203300
Breast Neoplasms Associate 24413080, 26745129, 40191190
Breast Neoplasms Inhibit 29138345
Hemorrhage Associate 37203300
Neoplasms Associate 40191190