PRSS55 (serine protease 55)

Gene

• Entrez ID: 203074
• Gene name: Serine protease 55
• Gene symbol: PRSS55
• Synonyms (NCBI Gene): CT153, T-SP1, TSP1, UNQ9391
• Chromosome: 8
• Chromosome location: 8p23.1
• Summary: This gene encodes a member of a group of membrane-anchored chymotrypsin (S1)-like serine proteases. The enocoded protein is primarily expressed in the Leydig and Sertoli cells of the testis and may be involved in male fertility. Alternate splicing results

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1268611	hsa-miR-3119	CLIP-seq
MIRT1268612	hsa-miR-3150a-3p	CLIP-seq
MIRT1268613	hsa-miR-3175	CLIP-seq
MIRT1268614	hsa-miR-3188	CLIP-seq
MIRT1268615	hsa-miR-4520a-3p	CLIP-seq
MIRT1268616	hsa-miR-4520b-3p	CLIP-seq
MIRT1268617	hsa-miR-570	CLIP-seq
MIRT1268618	hsa-miR-664	CLIP-seq
MIRT1268619	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001669	Component	Acrosomal vesicle	ISS
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	18844450
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18844450
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006508	Process	Proteolysis	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	ISS
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IBA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 615144
• HGNC: 30824
• e!Ensembl: ENSG00000184647

Protein

• UniProt ID: Q6UWB4
• Protein name: Serine protease 55 (EC 3.4.21.-) (Testis serine protease 1) (T-SP1)
• Protein function: Probable serine protease, which plays a crucial role in the fertility of male mice including sperm migration and sperm-egg interaction.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	68 → 295	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Only detected in testis. Expressed in spermatogonia, spermatocytes, spermatids, Leydig and Sertoli cells. Expressed in prostate cancer and ovarian cancer (at protein level). {ECO:0000269|PubMed:18844450, ECO:0000269|PubMed:23436708}.
• Sequence:

  MLLFSVLLLLSLVTGTQLGPRTPLPEAGVAILGRARGAHRPQPPHPPSPVSECGDRSIFE
  GRTRYSRITGGMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCLYSEELFPEEL
  SVVLGTNDLTSPSMEIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQ
  PGPATWRECWVAGWGQTNAADKNSVKTDLMKAPMVIMDWEECSKMFPKLTKNMLCAGYKN
  ESYDACKGDSGGPLVCTPEPGEKWYQVGIISWGKSCGEKNTPGIYTSLVNYNLWIEKVTQ
  LEGRPFNAEKRRTSVKQKPMGSPVSGVPEPGSPRSWLLLCPLSHVLFRAILY

• Sequence length: 352

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BARRETT'S ESOPHAGUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations