TSNARE1 (t-SNARE domain containing 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
203062
Gene name Gene Name - the full gene name approved by the HGNC.
T-SNARE domain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TSNARE1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(43)
miRTarBase ID miRNA Experiments Reference
MIRT017957 hsa-miR-335-5p Microarray 18185580
MIRT514820 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT514819 hsa-miR-190a-3p HITS-CLIP 21572407
MIRT514818 hsa-miR-3924 HITS-CLIP 21572407
MIRT514817 hsa-miR-1277-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0000149 Function SNARE binding IBA
GO:0005484 Function SNAP receptor activity IBA
GO:0006886 Process Intracellular protein transport IBA
GO:0006906 Process Vesicle fusion IBA
GO:0008021 Component Synaptic vesicle IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
620986 26437 ENSG00000171045
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96NA8
Protein name t-SNARE domain-containing protein 1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13873 Myb_DNA-bind_5 124 → 201 Myb/SANT-like DNA-binding domain Domain
PF14523 Syntaxin_2 264 → 368 Syntaxin-like protein Domain
PF05739 SNARE 452 → 504 SNARE domain Family
Sequence 
MSYGSIARGGGLGSRGPFGGPSRQGCQPLECARCWTEYGIRHFPCPSPESKLQNRCVGKD
GEGDLGPAGTPIVPRARKRGPGVAPEGSRMPEPTSSPTIGPRKDSAAGPHGRMAGPSTTR
AKKRKPNFCPQETEVLVSKVSKHHQLLFGTGLLKAEPTRRYRVWSRILQAVNALGYCRRD
VVDLKHKWRDLRAVVRRKLGDLRKAAHGPSPGSGKPQALALTPVEQVVAKTFSCQALPSE
GFSLEPPRATQVDPCNLQELFQEMSANVFRINSSVTSLERSLQSLGTPSDTQELRDSLHT
AQQETNKTIAASASSVKQMAELLRSSCPQERLQQERPQLDRLKTQLSDAIQCYGVVQKKI
AEKSRALLPMAQRGSKQSPQAPFAELADDEKVFNGSDNMWQGQEQALLPDITEEDLEAIR
LREEAILQMESNLLDVNQIIKDLASMVSEQGEAVDSIEASLEAASSHAEAARQLLAGASR
HQLQRHKIKCCFLSAGVTALLVIIIIIATSVRK
Sequence length 513
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (5)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Anxiety Disorder Anxiety N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Monoclonal Gammapathies Monoclonal gammopathy of undetermined significance N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Show/Hide Text Mining Associations (1)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Schizophrenia Associate 27668389, 34481484