Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2028
Gene name	Glutamyl aminopeptidase
Gene symbol	ENPEP
Synonyms (NCBI Gene)	APACD249gp160
Chromosome	4
Chromosome location	4q25
Summary	The ENPEP gene encodes glutamyl aminopeptidase, a type II integral membrane protein with an extracellular zinc-binding domain. This protein can upregulate blood pressure by cleaving the N-terminal aspartate from angiotensin II, and can regulate blood vess

Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044621	hsa-miR-320a	CLASH	23622248
MIRT437377	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	24098452
MIRT437377	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	24098452
MIRT963886	hsa-miR-129-5p	CLIP-seq
MIRT963887	hsa-miR-1297	CLIP-seq
MIRT963888	hsa-miR-1299	CLIP-seq
MIRT963889	hsa-miR-133a	CLIP-seq
MIRT963890	hsa-miR-133b	CLIP-seq
MIRT963891	hsa-miR-141	CLIP-seq
MIRT963892	hsa-miR-200a	CLIP-seq
MIRT963893	hsa-miR-2110	CLIP-seq
MIRT963894	hsa-miR-26a	CLIP-seq
MIRT963895	hsa-miR-26b	CLIP-seq
MIRT963896	hsa-miR-3150a-3p	CLIP-seq
MIRT963897	hsa-miR-3159	CLIP-seq
MIRT963898	hsa-miR-4271	CLIP-seq
MIRT963899	hsa-miR-4418	CLIP-seq
MIRT963900	hsa-miR-4465	CLIP-seq
MIRT963901	hsa-miR-4527	CLIP-seq
MIRT963902	hsa-miR-4725-3p	CLIP-seq
MIRT963903	hsa-miR-4726-3p	CLIP-seq
MIRT963904	hsa-miR-4760-3p	CLIP-seq
MIRT963905	hsa-miR-509-3-5p	CLIP-seq
MIRT963906	hsa-miR-509-5p	CLIP-seq
MIRT963907	hsa-miR-513a-3p	CLIP-seq
MIRT963908	hsa-miR-548a-3p	CLIP-seq
MIRT963909	hsa-miR-548e	CLIP-seq
MIRT963910	hsa-miR-548f	CLIP-seq
MIRT963911	hsa-miR-875-3p	CLIP-seq
MIRT963912	hsa-miR-9	CLIP-seq
MIRT1548343	hsa-miR-132	CLIP-seq
MIRT1548344	hsa-miR-212	CLIP-seq
MIRT1548345	hsa-miR-3157-5p	CLIP-seq
MIRT1548346	hsa-miR-4691-3p	CLIP-seq
MIRT1548347	hsa-miR-4709-5p	CLIP-seq
MIRT1985692	hsa-miR-105	CLIP-seq
MIRT1985693	hsa-miR-1295	CLIP-seq
MIRT1985694	hsa-miR-27a	CLIP-seq
MIRT1985695	hsa-miR-27b	CLIP-seq
MIRT1985696	hsa-miR-3150b-3p	CLIP-seq
MIRT1985697	hsa-miR-3658	CLIP-seq
MIRT1985698	hsa-miR-3977	CLIP-seq
MIRT1985699	hsa-miR-4257	CLIP-seq
MIRT1985700	hsa-miR-4662a-3p	CLIP-seq
MIRT1985701	hsa-miR-4717-5p	CLIP-seq
MIRT1985702	hsa-miR-4784	CLIP-seq
MIRT1985703	hsa-miR-513a-5p	CLIP-seq
MIRT1985704	hsa-miR-520d-5p	CLIP-seq
MIRT1985705	hsa-miR-524-5p	CLIP-seq
MIRT2220116	hsa-miR-1200	CLIP-seq
MIRT1985694	hsa-miR-27a	CLIP-seq
MIRT1985695	hsa-miR-27b	CLIP-seq
MIRT2220117	hsa-miR-3074-5p	CLIP-seq
MIRT2220118	hsa-miR-3124-3p	CLIP-seq
MIRT2220119	hsa-miR-3140-5p	CLIP-seq
MIRT2220120	hsa-miR-4753-3p	CLIP-seq
MIRT2220121	hsa-miR-4768-5p	CLIP-seq
MIRT1985703	hsa-miR-513a-5p	CLIP-seq
MIRT2220122	hsa-miR-942	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	ISS
GO:0002003	Process	Angiotensin maturation	IBA
GO:0002003	Process	Angiotensin maturation	IEA
GO:0002003	Process	Angiotensin maturation	NAS	19608358
GO:0003081	Process	Regulation of systemic arterial blood pressure by renin-angiotensin	IDA	19608358
GO:0003081	Process	Regulation of systemic arterial blood pressure by renin-angiotensin	NAS	8346219
GO:0004177	Function	Aminopeptidase activity	IDA	8244382, 10692253
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004230	Function	Glutamyl aminopeptidase activity	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10692253
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	8244382
GO:0005886	Component	Plasma membrane	TAS
GO:0005903	Component	Brush border	IEA
GO:0005903	Component	Brush border	ISS
GO:0006508	Process	Proteolysis	IEA
GO:0007267	Process	Cell-cell signaling	NAS	8346219
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IDA	14998491
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009897	Component	External side of plasma membrane	ISS
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0016477	Process	Cell migration	IDA	14998491
GO:0016787	Function	Hydrolase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	ISS
GO:0032835	Process	Glomerulus development	IEA
GO:0032835	Process	Glomerulus development	ISS
GO:0043171	Process	Peptide catabolic process	IBA
GO:0045177	Component	Apical part of cell	IEA
GO:0045177	Component	Apical part of cell	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0070006	Function	Metalloaminopeptidase activity	IBA
GO:0070006	Function	Metalloaminopeptidase activity	IDA	8346219, 23888046
GO:0070006	Function	Metalloaminopeptidase activity	NAS	8244382
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
138297	3355	ENSG00000138792

Q07075

Protein name

Glutamyl aminopeptidase (EAP) (EC 3.4.11.7) (Aminopeptidase A) (AP-A) (Differentiation antigen gp160) (CD antigen CD249)

Protein function

Regulates central hypertension through its calcium-modulated preference to cleave N-terminal acidic residues from peptides such as angiotensin II.

PDB

4KX7 , 4KX8 , 4KX9 , 4KXA , 4KXB , 4KXC , 4KXD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17900	Peptidase_M1_N	98 → 286		Domain
PF01433	Peptidase_M1	321 → 538	Peptidase family M1 domain	Domain
PF11838	ERAP1_C	616 → 934	ERAP1-like C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in choriocarcinoma cancer cell lines (at protein level) (PubMed:10692253). Expressed by epithelial cells of the proximal tubule cells and the glomerulus of the nephron. Also found in a variety of other tissues. {ECO:0000269|P

Sequence

MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHL
PSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVS
ISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPS
SGDGLYLLTMEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKK
ATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI
SNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAME
NWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS
FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYS
KGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTR
QMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE
KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLID
DAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYPMIEEYF
QGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPV
NLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK
DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN
TELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG

Sequence length

957

Interactions

View interactions

	KEGG		Reactome
	Renin-angiotensin system		Metabolism of Angiotensinogen to Angiotensins

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign	rs34631771	RCV005911617
Clear cell carcinoma of kidney	Benign	rs34631771	RCV005911618
Gastric cancer	Benign	rs34631771	RCV005911620
Hepatocellular carcinoma	Benign	rs34631771	RCV005911616
Ovarian serous cystadenocarcinoma	Benign	rs34631771	RCV005911621
Sarcoma	Benign	rs34631771	RCV005911619
Thymoma	Benign	rs34631771	RCV005911623
Thyroid cancer, nonmedullary, 1	Benign	rs34631771	RCV005911624
Uterine carcinosarcoma	Benign	rs34631771	RCV005911622
Uterine corpus endometrial carcinoma	Benign	rs34631771	RCV005911625

Show/Hide Text Mining Associations (30)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Albuminuria	Associate	18206321
Asthma	Stimulate	36012391
Breast Neoplasms	Associate	24098452, 36936167
Carcinogenesis	Associate	34862755
Carcinoma Renal Cell	Associate	16985214, 24885240, 8346219, 9486416
Carcinoma Renal Cell	Inhibit	18216146, 28809959
Colorectal Neoplasms	Stimulate	34285715
Colorectal Neoplasms	Associate	37359548
COVID 19	Associate	32199615
Endocarditis	Associate	30686615
Esophageal Squamous Cell Carcinoma	Associate	36412985
Hereditary Breast and Ovarian Cancer Syndrome	Associate	24098452
HIV Infections	Associate	32493720
HTLV I Infections	Associate	15266112
Hypertension	Associate	18550936, 37451613
Hypertension Renal	Associate	18206321
Infections	Associate	10656175, 38289101
Kidney Diseases	Associate	18206321
Kidney Neoplasms	Associate	18216146, 24885240, 28809959
Mitochondrial Diseases	Associate	11739707
Mitral Valve Insufficiency	Associate	30581499
Neoplasms	Associate	1719230, 24885240, 28809959, 37359548, 9486416
Neoplasms	Inhibit	18216146
Neoplasms	Stimulate	24098452
Neurotoxicity Syndromes	Stimulate	32340109
Oncocytoma renal	Inhibit	18216146
Osteoarthritis	Associate	37006267
Parkinson Disease	Associate	33481347
Pulmonary Disease Chronic Obstructive	Stimulate	36012391
Viremia	Associate	30842323

ENPEP (glutamyl aminopeptidase)