Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2022
Gene name Gene Name - the full gene name approved by the HGNC.
Endoglin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ENG
Synonyms (NCBI Gene) Gene synonyms aliases
END, HHT1, ORW1
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q34.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high aff
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs267606783 A>C,G Pathogenic Initiator codon variant, missense variant, genic upstream transcript variant
rs368423516 C>G,T Likely-benign, pathogenic Genic upstream transcript variant, 5 prime UTR variant
rs369596004 C>- Pathogenic 5 prime UTR variant, frameshift variant, coding sequence variant
rs755348996 C>A,T Pathogenic, likely-pathogenic Coding sequence variant, synonymous variant, 5 prime UTR variant
rs773334730 G>A,C Likely-pathogenic Intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT032385 hsa-let-7b-5p Proteomics 18668040
MIRT493966 hsa-miR-4781-5p PAR-CLIP 23592263
MIRT493965 hsa-miR-6823-5p PAR-CLIP 23592263
MIRT493964 hsa-miR-1909-3p PAR-CLIP 23592263
MIRT493963 hsa-miR-6722-3p PAR-CLIP 23592263
Transcription factors
Transcription factor Regulation Reference
ERG Activation 22235125
ERG Unknown 19359602
SP1 Activation 21146604
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 18974388
GO:0001525 Process Angiogenesis IEA
GO:0001525 Process Angiogenesis IEA
GO:0001569 Process Branching involved in blood vessel morphogenesis IEA
GO:0001569 Process Branching involved in blood vessel morphogenesis ISS 8194490
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
131195 3349 ENSG00000106991
Protein
UniProt ID P17813
Protein name Endoglin (CD antigen CD105)
Protein function Vascular endothelium glycoprotein that plays an important role in the regulation of angiogenesis (PubMed:21737454, PubMed:23300529). Required for normal structure and integrity of adult vasculature (PubMed:7894484). Regulates the migration of va
PDB 5HZV , 5HZW , 5I04
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00100 Zona_pellucida 363 563 Zona pellucida-like domain Family
Tissue specificity TISSUE SPECIFICITY: Detected on umbilical veil endothelial cells (PubMed:10625079). Detected in placenta (at protein level) (PubMed:1692830). Detected on endothelial cells (PubMed:1692830). {ECO:0000269|PubMed:10625079, ECO:0000269|PubMed:1692830}.
Sequence
MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNA
ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAY
NSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLS
FCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVEL
SCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLL
GEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQ
TKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASM
ISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVS
PSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVP
IPKTGTLSCTVALRPKTGSQDQE
VHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAF
LIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA
Sequence length 658
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hereditary Hemorrhagic Telangiectasia hereditary hemorrhagic telangiectasia rs886041326, rs1564455604, rs121918402, rs1554812253, rs1830385077, rs1085307433, rs1588582870, rs1554810257, rs1564452747, rs1060501420, rs1554809331, rs1197761705, rs1554809455, rs1064793734, rs1434169817
View all (136 more)
N/A
Pulmonary arterial hypertension pulmonary arterial hypertension rs374644720, rs1588573831, rs886039506 N/A
pulmonary arterial hypertension related to hereditary hemorrhagic telangiectasia Pulmonary arterial hypertension related to hereditary hemorrhagic telangiectasia rs1085307432, rs1085307430, rs1085307435, rs1085307434, rs1085307433 N/A
Pulmonary Hypertension pulmonary hypertension, primary, 1 rs1085307436 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Galloway-Mowat Syndrome galloway-mowat syndrome 1 N/A N/A ClinVar
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Polyposis Syndrome juvenile polyposis syndrome N/A N/A GenCC
Pulmonary Arterial Hypertension Associated With Congenital Heart Disease pulmonary arterial hypertension associated with congenital heart disease N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 23893879
Adenocarcinoma of Lung Associate 28178989, 33661044, 35635202
Adjustment Disorders Associate 21078485
Arteriovenous Fistula Associate 33353465
Arteriovenous Malformations Associate 10702408, 16155196, 18673552, 19508727, 26041630, 29048420, 31510822, 32503579, 32847536, 39939156, 8728706
Arteriovenous Malformations Stimulate 12843319, 12920067
Arthritis Psoriatic Associate 9498020
Arthritis Rheumatoid Stimulate 12009077
Atherosclerosis Associate 16733295, 28901429, 34602076
Bicuspid Aortic Valve Disease Associate 20098615