Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
202018
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane anterior posterior transformation 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TAPT1
Synonyms (NCBI Gene) Gene synonyms aliases
CMVFR, OCLSBG
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p15.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a highly conserved protein that localizes to the centrosome and/or ciliary basal body. Mutations in this gene disrupt Golgi morphology and trafficking and normal primary cilium formation and these mutations are congenitally manifested by
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs869312980 T>A Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs869320633 C>G Pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017563 hsa-miR-335-5p Microarray 18185580
MIRT044889 hsa-miR-193a-3p CLASH 23622248
MIRT439485 hsa-miR-155-5p HITS-CLIP 22473208
MIRT439485 hsa-miR-155-5p HITS-CLIP 22473208
MIRT1411326 hsa-miR-1238 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001503 Process Ossification IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005789 Component Endoplasmic reticulum membrane IBA
GO:0005813 Component Centrosome IDA 26365339
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612758 26887 ENSG00000169762
Protein
UniProt ID Q6NXT6
Protein name Transmembrane anterior posterior transformation protein 1 homolog (Cytomegalovirus partial fusion receptor)
Protein function Plays a role in primary cilia formation (PubMed:26365339). May act as a downstream effector of HOXC8 possibly by transducing or transmitting extracellular information required for axial skeletal patterning during development (By similarity). May
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05346 DUF747 155 459 Eukaryotic membrane protein family Family
Sequence
MAGVGDAAAPGEGGGGGVDGPQRDGRGEAEQPGGSGGQGPPPAPQLTETLGFYESDRRRE
RRRGRTELSLLRFLSAELTRGYFLEHNEAKYTERRERVYTCLRIPRELEKLMVFGIFLCL
DAFLYVFTLLPLRVFLALFRLLTLPCYGLRDRRLLQPAQVCDILKGVILVICYFMMHYVD
YSMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATEPKERKRAHIGVIP
HFFMAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLF
QMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEIAVDIVKHAFI
TKFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSS
IKVQGILSYACVILFYFGLISLKVLNSIVLLGKSCQYVK
EAKMEEKLSNPPATCTPGKPS
SKSQNKCKPSQGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQD
NSELKHRSSKKDLLEIDRFTICGNRID
Sequence length 567
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Lethal Osteochondrodysplasia complex lethal osteochondrodysplasia rs869320633, rs869312980 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cataract cataract N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 33374314
Neoplasms Associate 31912669
Osteogenesis Imperfecta Associate 36652330, 37292039
Progeria Associate 36652330
Progeroid syndrome neonatal Associate 36652330