Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2020
Gene name Gene Name - the full gene name approved by the HGNC.
Engrailed homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EN2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q36.3
Summary Summary of gene provided in NCBI Entrez Gene.
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the `engrailed` (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Differe
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027200 hsa-miR-103a-3p Sequencing 20371350
MIRT032001 hsa-miR-16-5p Sequencing 20371350
MIRT051493 hsa-let-7e-5p CLASH 23622248
MIRT043555 hsa-miR-331-3p CLASH 23622248
MIRT037416 hsa-miR-744-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001650 Component Fibrillar center IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
131310 3343 ENSG00000164778
Protein
UniProt ID P19622
Protein name Homeobox protein engrailed-2 (Homeobox protein en-2) (Hu-En-2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 245 301 Homeodomain Domain
PF10525 Engrail_1_C_sig 302 332 Engrailed homeobox C-terminal signature domain Domain
Sequence
MEENDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNH
QHPHRITNFFIDNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQ
LLGSGSREPRQNPPCAPGAGGPLPAAGSDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGS
LKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWPAWVYCTRYSDRPSSGPRSRKPKKKNP
NKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIK
K
ATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
Sequence length 333
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Autism NON RARE IN EUROPE: Autism, Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
19186208, 15024396, 20523082, 16935268
Autism spectrum disorder Autism Spectrum Disorders rs724159978, rs75184679, rs119103221, rs9332964, rs121912562, rs1594344233, rs727504317, rs111033204, rs1801086, rs587784464, rs724159948, rs764659822, rs794727977, rs796052733, rs796052728
View all (51 more)
25290267
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
15123388, 24730055
Unknown
Disease term Disease name Evidence References Source
Neurodevelopmental Disorders complex neurodevelopmental disorder GenCC
Associations from Text Mining
Disease Name Relationship Type References
Aphasia Associate 27251476
Autism Spectrum Disorder Associate 16252243, 28081867
Autistic Disorder Associate 23423141, 25290267
Breast Neoplasms Associate 24786097
Carcinoma Ovarian Epithelial Associate 30285763
Carcinoma Renal Cell Associate 24786097
Cerebellar Diseases Associate 23423141
Colorectal Neoplasms Associate 33685351, 35169223
Cytomegalovirus Infections Associate 28343438
Developmental Disabilities Associate 27251476