Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2019
Gene name Gene Name - the full gene name approved by the HGNC.	Engrailed homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EN1
Synonyms (NCBI Gene) Gene synonyms aliases	ENDOVESLB
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q14.2
Summary Summary of gene provided in NCBI Entrez Gene.	Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the `engrailed` (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Differe

Show/Hide all(116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT493975	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT493974	hsa-miR-3960	PAR-CLIP	20371350
MIRT493973	hsa-miR-8072	PAR-CLIP	20371350
MIRT493972	hsa-miR-4746-3p	PAR-CLIP	20371350
MIRT493971	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT493970	hsa-miR-4467	PAR-CLIP	20371350
MIRT493975	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT493974	hsa-miR-3960	PAR-CLIP	23592263
MIRT493973	hsa-miR-8072	PAR-CLIP	23592263
MIRT493972	hsa-miR-4746-3p	PAR-CLIP	23592263
MIRT493971	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT493970	hsa-miR-4467	PAR-CLIP	23592263
MIRT493968	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT493969	hsa-miR-128-1-5p	PAR-CLIP	23592263
MIRT493967	hsa-miR-128-2-5p	PAR-CLIP	23592263
MIRT493969	hsa-miR-128-1-5p	PAR-CLIP	26701625
MIRT493969	hsa-miR-128-1-5p	PAR-CLIP	26701625
MIRT493969	hsa-miR-128-1-5p	PAR-CLIP	26701625
MIRT493969	hsa-miR-128-1-5p	PAR-CLIP	26701625
MIRT493969	hsa-miR-128-1-5p	PAR-CLIP	26701625
MIRT493969	hsa-miR-128-1-5p	PAR-CLIP	26701625
MIRT493967	hsa-miR-128-2-5p	PAR-CLIP	26701625
MIRT493967	hsa-miR-128-2-5p	PAR-CLIP	26701625
MIRT493967	hsa-miR-128-2-5p	PAR-CLIP	26701625
MIRT493967	hsa-miR-128-2-5p	PAR-CLIP	26701625
MIRT493967	hsa-miR-128-2-5p	PAR-CLIP	26701625
MIRT493967	hsa-miR-128-2-5p	PAR-CLIP	26701625
MIRT493971	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT493971	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT493971	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT493971	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT493971	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT493971	hsa-miR-139-3p	PAR-CLIP	26701625
MIRT493974	hsa-miR-3960	PAR-CLIP	26701625
MIRT493974	hsa-miR-3960	PAR-CLIP	26701625
MIRT493974	hsa-miR-3960	PAR-CLIP	26701625
MIRT493974	hsa-miR-3960	PAR-CLIP	26701625
MIRT493974	hsa-miR-3960	PAR-CLIP	26701625
MIRT493974	hsa-miR-3960	PAR-CLIP	26701625
MIRT493970	hsa-miR-4467	PAR-CLIP	26701625
MIRT493970	hsa-miR-4467	PAR-CLIP	26701625
MIRT493970	hsa-miR-4467	PAR-CLIP	26701625
MIRT493970	hsa-miR-4467	PAR-CLIP	26701625
MIRT493970	hsa-miR-4467	PAR-CLIP	26701625
MIRT493970	hsa-miR-4467	PAR-CLIP	26701625
MIRT493972	hsa-miR-4746-3p	PAR-CLIP	26701625
MIRT493972	hsa-miR-4746-3p	PAR-CLIP	26701625
MIRT493972	hsa-miR-4746-3p	PAR-CLIP	26701625
MIRT493972	hsa-miR-4746-3p	PAR-CLIP	26701625
MIRT493972	hsa-miR-4746-3p	PAR-CLIP	26701625
MIRT493972	hsa-miR-4746-3p	PAR-CLIP	26701625
MIRT493975	hsa-miR-6746-5p	PAR-CLIP	26701625
MIRT493975	hsa-miR-6746-5p	PAR-CLIP	26701625
MIRT493975	hsa-miR-6746-5p	PAR-CLIP	26701625
MIRT493975	hsa-miR-6746-5p	PAR-CLIP	26701625
MIRT493975	hsa-miR-6746-5p	PAR-CLIP	26701625
MIRT493975	hsa-miR-6746-5p	PAR-CLIP	26701625
MIRT493968	hsa-miR-6781-5p	PAR-CLIP	26701625
MIRT493968	hsa-miR-6781-5p	PAR-CLIP	26701625
MIRT493968	hsa-miR-6781-5p	PAR-CLIP	26701625
MIRT493968	hsa-miR-6781-5p	PAR-CLIP	26701625
MIRT493968	hsa-miR-6781-5p	PAR-CLIP	26701625
MIRT493968	hsa-miR-6781-5p	PAR-CLIP	26701625
MIRT493973	hsa-miR-8072	PAR-CLIP	26701625
MIRT493973	hsa-miR-8072	PAR-CLIP	26701625
MIRT493973	hsa-miR-8072	PAR-CLIP	26701625
MIRT493973	hsa-miR-8072	PAR-CLIP	26701625
MIRT493973	hsa-miR-8072	PAR-CLIP	26701625
MIRT493973	hsa-miR-8072	PAR-CLIP	26701625
MIRT493975	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT493974	hsa-miR-3960	PAR-CLIP	20371350
MIRT493973	hsa-miR-8072	PAR-CLIP	20371350
MIRT493972	hsa-miR-4746-3p	PAR-CLIP	20371350
MIRT493971	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT493970	hsa-miR-4467	PAR-CLIP	20371350
MIRT493975	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT493974	hsa-miR-3960	PAR-CLIP	23592263
MIRT493973	hsa-miR-8072	PAR-CLIP	23592263
MIRT493972	hsa-miR-4746-3p	PAR-CLIP	23592263
MIRT493971	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT493970	hsa-miR-4467	PAR-CLIP	23592263
MIRT493968	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT493969	hsa-miR-128-1-5p	PAR-CLIP	23592263
MIRT493967	hsa-miR-128-2-5p	PAR-CLIP	23592263
MIRT962765	hsa-miR-1253	CLIP-seq
MIRT962766	hsa-miR-1275	CLIP-seq
MIRT738430	hsa-miR-1470	CLIP-seq
MIRT738432	hsa-miR-1539	CLIP-seq
MIRT962767	hsa-miR-198	CLIP-seq
MIRT962768	hsa-miR-3175	CLIP-seq
MIRT738428	hsa-miR-3189-3p	CLIP-seq
MIRT962769	hsa-miR-338-3p	CLIP-seq
MIRT962770	hsa-miR-3689d	CLIP-seq
MIRT962771	hsa-miR-4434	CLIP-seq
MIRT738435	hsa-miR-4446-5p	CLIP-seq
MIRT962772	hsa-miR-4447	CLIP-seq
MIRT738431	hsa-miR-4469	CLIP-seq
MIRT962773	hsa-miR-4472	CLIP-seq
MIRT962774	hsa-miR-4516	CLIP-seq
MIRT962775	hsa-miR-4525	CLIP-seq
MIRT962776	hsa-miR-4530	CLIP-seq
MIRT962777	hsa-miR-4665-5p	CLIP-seq
MIRT738429	hsa-miR-4667-3p	CLIP-seq
MIRT962778	hsa-miR-4723-5p	CLIP-seq
MIRT738434	hsa-miR-4755-5p	CLIP-seq
MIRT962779	hsa-miR-541	CLIP-seq
MIRT962780	hsa-miR-545	CLIP-seq
MIRT962781	hsa-miR-548c-3p	CLIP-seq
MIRT962782	hsa-miR-625	CLIP-seq
MIRT962783	hsa-miR-654-5p	CLIP-seq
MIRT738433	hsa-miR-670	CLIP-seq
MIRT1985374	hsa-miR-4261	CLIP-seq
MIRT1985375	hsa-miR-4639-3p	CLIP-seq
MIRT1985376	hsa-miR-603	CLIP-seq
MIRT1985377	hsa-miR-607	CLIP-seq
MIRT738431	hsa-miR-4469	CLIP-seq

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	21672318
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	21672318
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	21672318
GO:0001501	Process	Skeletal system development	TAS	8684466
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	24399192
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0009653	Process	Anatomical structure morphogenesis	TAS	8094370
GO:0009953	Process	Dorsal/ventral pattern formation	IEA
GO:0009954	Process	Proximal/distal pattern formation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030901	Process	Midbrain development	IEA
GO:0030902	Process	Hindbrain development	IEA
GO:0030917	Process	Midbrain-hindbrain boundary development	IEA
GO:0035115	Process	Embryonic forelimb morphogenesis	IEA
GO:0035176	Process	Social behavior	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042756	Process	Drinking behavior	IEA
GO:0043473	Process	Pigmentation	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048666	Process	Neuron development	IEA
GO:0060173	Process	Limb development	IEA
GO:0061743	Process	Motor learning	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	TAS	24431302
GO:1990403	Process	Embryonic brain development	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
131290	3342	ENSG00000163064

Protein

UniProt ID

Q05925

Protein name

Homeobox protein engrailed-1 (Homeobox protein en-1) (Hu-En-1)

Protein function

Required for proper formation of the apical ectodermal ridge and correct dorsal-ventral patterning in the limb.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	304 → 360	Homeodomain	Domain
PF10525	Engrail_1_C_sig	361 → 391	Engrailed homeobox C-terminal signature domain	Domain

Sequence

MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPP
AAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKE
QPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPP
DGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGT
KYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNE
KEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKK
ATGIKNGLALHLMAQGLYNHSTTTVQDKDESE

Sequence length

392

Interactions

View interactions

EN1 (engrailed homeobox 1)