Gene Gene information from NCBI Gene database.
Entrez ID 2019
Gene name Engrailed homeobox 1
Gene symbol EN1
Synonyms (NCBI Gene)
ENDOVESLB
Chromosome 2
Chromosome location 2q14.2
Summary Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the `engrailed` (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Differe
miRNA miRNA information provided by mirtarbase database.
116
miRTarBase ID miRNA Experiments Reference
MIRT493975 hsa-miR-6746-5p PAR-CLIP 20371350
MIRT493974 hsa-miR-3960 PAR-CLIP 20371350
MIRT493973 hsa-miR-8072 PAR-CLIP 20371350
MIRT493972 hsa-miR-4746-3p PAR-CLIP 20371350
MIRT493971 hsa-miR-139-3p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
43
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 21672318
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 21672318
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
131290 3342 ENSG00000163064
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q05925
Protein name Homeobox protein engrailed-1 (Homeobox protein en-1) (Hu-En-1)
Protein function Required for proper formation of the apical ectodermal ridge and correct dorsal-ventral patterning in the limb.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 304 360 Homeodomain Domain
PF10525 Engrail_1_C_sig 361 391 Engrailed homeobox C-terminal signature domain Domain
Sequence
MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPP
AAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKE
QPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPP
DGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGT
KYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNE
KEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKK
ATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
Sequence length 392
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EN1 syndrome Pathogenic rs1678284190 RCV001270919
ENDOVE syndrome, limb-brain type Pathogenic rs1678284190 RCV001303207
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EN1-related disorder Likely benign rs544035952, rs758084818 RCV003911464
RCV003954686
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Associate 19384295
Brain Neoplasms Stimulate 31239270
Breast Neoplasms Associate 24141779, 29333926, 34287743
Carcinoma Adenoid Cystic Associate 21692051, 21800291, 26953815
Colorectal Neoplasms Associate 18403637, 19384295
Death Inhibit 24141779
Disease Associate 19384295
Inflammation Associate 24141779
Lesch Nyhan Syndrome Associate 40710358
Neoplasm Metastasis Associate 31239270