Gene Gene information from NCBI Gene database.
Entrez ID 2016
Gene name Empty spiracles homeobox 1
Gene symbol EMX1
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2p13.2
miRNA miRNA information provided by mirtarbase database.
136
miRTarBase ID miRNA Experiments Reference
MIRT447814 hsa-miR-100-3p PAR-CLIP 22100165
MIRT447813 hsa-miR-3125 PAR-CLIP 22100165
MIRT447812 hsa-miR-3916 PAR-CLIP 22100165
MIRT447811 hsa-miR-6859-5p PAR-CLIP 22100165
MIRT447810 hsa-miR-3928-3p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600034 3340 ENSG00000135638
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q04741
Protein name Homeobox protein EMX1 (Empty spiracles homolog 1) (Empty spiracles-like protein 1)
Protein function Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous syste
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 160 216 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Cerebral cortex.
Sequence
MFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLAAAASEEPLRPTALNYPHPSAAEA
AFVSGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHR
DPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEK
NHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKR
QKLEEEGPESEQKKKGSHHINRWR
IATKQANGEDIDVTSND
Sequence length 257
Interactions View interactions