Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
201294
Gene name Gene Name - the full gene name approved by the HGNC.
Unc-13 homolog D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
UNC13D
Synonyms (NCBI Gene) Gene synonyms aliases
FHL3, HLH3, HPLH3, Munc13-4
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs117221419 T>G Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance Coding sequence variant, missense variant
rs121434352 G>A,C Pathogenic Coding sequence variant, missense variant, stop gained
rs121434353 A>G Pathogenic Coding sequence variant, missense variant
rs121434354 A>C,T Pathogenic Coding sequence variant, missense variant
rs138760432 C>G Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017327 hsa-miR-335-5p Microarray 18185580
MIRT023568 hsa-miR-1-3p Proteomics 18668040
MIRT032278 hsa-let-7b-5p Proteomics 18668040
MIRT044594 hsa-miR-320a CLASH 23622248
MIRT650869 hsa-miR-665 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002432 Process Granuloma formation IEA
GO:0002467 Process Germinal center formation IEA
GO:0005515 Function Protein binding IPI 15548590, 16278825, 25312756, 26627825, 33513601
GO:0005576 Component Extracellular region TAS
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608897 23147 ENSG00000092929
Protein
UniProt ID Q70J99
Protein name Protein unc-13 homolog D (Munc13-4)
Protein function Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse. Regulates assembly of recycling and late endosomal structures, leading to the formation
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00168 C2 112 263 C2 domain Domain
PF10540 Membr_traf_MHD 830 894 Munc13 (mammalian uncoordinated) homology domain Domain
PF00168 C2 925 1039 C2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in spleen, thymus and leukocytes. Also expressed in lung and placenta, and at very low levels in brain, heart, skeletal muscle and kidney. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells. {ECO:0000269
Sequence
MATLLSHPQQRPPFLRQAIKIRRRRVRDLQDPPPQMAPEIQPPSHHFSPEQRALLYEDAL
YTVLHRLGHPEPNHVTEASELLRYLQEAFHVEPEEHQQTLQRVRELEKPIFCLKATVKQA
KGILGKDVSGFSDPYCLLGIEQGVGVPGGSPGSRHRQKAVVRHTIPEEETHRTQVITQTL
NPVWDETFILEFEDITNASFHLDMWDLDTVESVRQKLGELTDLHGLRRIFKEARKDKGQD
DFLGNVVLRLQDLRCREDQWYPL
EPRTETYPDRGQCHLQFQLIHKRRATSASRSQPSYTV
HLHLLQQLVSHEVTQHEAGSTSWDGSLSPQAATVLFLHATQKDLSDFHQSMAQWLAYSRL
YQSLEFPSSCLLHPITSIEYQWIQGRLKAEQQEELAASFSSLLTYGLSLIRRFRSVFPLS
VSDSPARLQSLLRVLVQMCKMKAFGELCPNTAPLPQLVTEALQTGTTEWFHLKQQHHQPM
VQGIPEAGKALLGLVQDVIGDLHQCQRTWDKIFHNTLKIHLFSMAFRELQWLVAKRVQDH
TTVVGDVVSPEMGESLFQLYISLKELCQLRMSSSERDGVLALDNFHRWFQPAIPSWLQKT
YNEALARVQRAVQMDELVPLGELTKHSTSAVDLSTCFAQISHTARQLDWPDPEEAFMITV
KFVEDTCRLALVYCSLIKARARELSSGQKDQGQAANMLCVVVNDMEQLRLVIGKLPAQLA
WEALEQRVGAVLEQGQLQNTLHAQLQSALAGLGHEIRTGVRTLAEQLEVGIAKHIQKLVG
VRESVLPEDAILPLMKFLEVELCYMNTNLVQENFSSLLTLLWTHTLTVLVEAAASQRSSS
LASNRLKIALQNLEICFHAEGCGLPPKALHTATFQALQRDLELQAASSRELIRK
YFCSRI
QQQAETTSEELGAVTVKASYRASEQKLRVELLSASSLLPLDSNGSSDPFVQLTLEPRHEF
PELAARETQKHKKDLHPLFDETFEFLVPAEPCRKAGACLLLTVLDYDTLGADDLEGEAFL
PLREVPGLSGSEEPGEVPQ
TRLPLTYPAPNGDPILQLLEGRKGDREAQVFVRLRRHRAKQ
ASQHALRPAP
Sequence length 1090
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Autoinflammatory Disease Autoinflammatory syndrome rs764196809, rs777759523, rs121434352, rs1274685768, rs766657895 N/A
Hemophagocytic Lymphohistiocytosis Familial hemophagocytic lymphohistiocytosis 3, familial hemophagocytic lymphohistiocytosis rs763117746, rs765034513, rs777759523, rs1567818774, rs910650073, rs764196809, rs1567816070, rs933702160, rs121434352, rs1555601863, rs1278701043, rs1599414759, rs1555600214, rs1567818219, rs1442964152
View all (20 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Nonatopic asthma, Asthma (adult onset), Asthma N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Mental Depression Major depressive disorder N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Juvenile Associate 18240215, 18759271, 25047945, 29409136
Autoimmune Lymphoproliferative Syndrome Associate 23840885
Chediak Higashi Syndrome Associate 25425525
Compassion Fatigue Stimulate 32375849
COVID 19 Associate 33867526
Cytokine Release Syndrome Associate 33867526
Dental Plaque Associate 26377049
Dianzani autoimmune lymphoproliferative syndrome Associate 23840885
Drug Related Side Effects and Adverse Reactions Associate 18492689, 24842371, 30758854
Dykes Markes Harper syndrome Associate 32245292