Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	201181
Gene name	Zinc finger protein 385C
Gene symbol	ZNF385C
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17q21.2

Show/Hide all (78)

miRTarBase ID	miRNA	Experiments
MIRT1523603	hsa-miR-1207-5p	CLIP-seq
MIRT1523604	hsa-miR-1255a	CLIP-seq
MIRT1523605	hsa-miR-1255b	CLIP-seq
MIRT1523606	hsa-miR-127-5p	CLIP-seq
MIRT1523607	hsa-miR-128	CLIP-seq
MIRT1523608	hsa-miR-1285	CLIP-seq
MIRT1523609	hsa-miR-1909	CLIP-seq
MIRT1523610	hsa-miR-1910	CLIP-seq
MIRT1523611	hsa-miR-2114	CLIP-seq
MIRT1523612	hsa-miR-27a	CLIP-seq
MIRT1523613	hsa-miR-27b	CLIP-seq
MIRT1523614	hsa-miR-3126-5p	CLIP-seq
MIRT1523615	hsa-miR-3144-5p	CLIP-seq
MIRT1523616	hsa-miR-3150b-3p	CLIP-seq
MIRT1523617	hsa-miR-3173-3p	CLIP-seq
MIRT1523618	hsa-miR-3183	CLIP-seq
MIRT1523619	hsa-miR-3187-5p	CLIP-seq
MIRT1523620	hsa-miR-3189-3p	CLIP-seq
MIRT1523621	hsa-miR-3191	CLIP-seq
MIRT1523622	hsa-miR-3689a-3p	CLIP-seq
MIRT1523623	hsa-miR-3689c	CLIP-seq
MIRT1523624	hsa-miR-4303	CLIP-seq
MIRT1523625	hsa-miR-4419a	CLIP-seq
MIRT1523626	hsa-miR-4424	CLIP-seq
MIRT1523627	hsa-miR-4425	CLIP-seq
MIRT1523628	hsa-miR-4459	CLIP-seq
MIRT1523629	hsa-miR-4492	CLIP-seq
MIRT1523630	hsa-miR-4498	CLIP-seq
MIRT1523631	hsa-miR-4510	CLIP-seq
MIRT1523632	hsa-miR-4649-3p	CLIP-seq
MIRT1523633	hsa-miR-4652-5p	CLIP-seq
MIRT1523634	hsa-miR-4723-3p	CLIP-seq
MIRT1523635	hsa-miR-4736	CLIP-seq
MIRT1523636	hsa-miR-4763-3p	CLIP-seq
MIRT1523637	hsa-miR-4779	CLIP-seq
MIRT1523638	hsa-miR-4784	CLIP-seq
MIRT1523639	hsa-miR-4793-3p	CLIP-seq
MIRT1523640	hsa-miR-490-3p	CLIP-seq
MIRT1523641	hsa-miR-491-5p	CLIP-seq
MIRT1523642	hsa-miR-499-3p	CLIP-seq
MIRT1523643	hsa-miR-499a-3p	CLIP-seq
MIRT1523644	hsa-miR-513a-5p	CLIP-seq
MIRT1523645	hsa-miR-612	CLIP-seq
MIRT1523646	hsa-miR-649	CLIP-seq
MIRT1523647	hsa-miR-762	CLIP-seq
MIRT1523648	hsa-miR-765	CLIP-seq
MIRT1523649	hsa-miR-767-5p	CLIP-seq
MIRT1523610	hsa-miR-1910	CLIP-seq
MIRT1555813	hsa-miR-22	CLIP-seq
MIRT1523620	hsa-miR-3189-3p	CLIP-seq
MIRT1555814	hsa-miR-3202	CLIP-seq
MIRT1555815	hsa-miR-3714	CLIP-seq
MIRT1555816	hsa-miR-4533	CLIP-seq
MIRT1555817	hsa-miR-938	CLIP-seq
MIRT2158239	hsa-miR-1324	CLIP-seq
MIRT2158240	hsa-miR-3153	CLIP-seq
MIRT1555814	hsa-miR-3202	CLIP-seq
MIRT2158241	hsa-miR-4330	CLIP-seq
MIRT1555816	hsa-miR-4533	CLIP-seq
MIRT1523648	hsa-miR-765	CLIP-seq
MIRT1523608	hsa-miR-1285	CLIP-seq
MIRT2377768	hsa-miR-25	CLIP-seq
MIRT1523619	hsa-miR-3187-5p	CLIP-seq
MIRT2377769	hsa-miR-32	CLIP-seq
MIRT2377770	hsa-miR-363	CLIP-seq
MIRT2377771	hsa-miR-367	CLIP-seq
MIRT1523639	hsa-miR-4793-3p	CLIP-seq
MIRT1523640	hsa-miR-490-3p	CLIP-seq
MIRT1523645	hsa-miR-612	CLIP-seq
MIRT1523646	hsa-miR-649	CLIP-seq
MIRT1523649	hsa-miR-767-5p	CLIP-seq
MIRT2377772	hsa-miR-92a	CLIP-seq
MIRT2377773	hsa-miR-92b	CLIP-seq
MIRT2464236	hsa-miR-1245b-3p	CLIP-seq
MIRT2464237	hsa-miR-2278	CLIP-seq
MIRT2464238	hsa-miR-3943	CLIP-seq
MIRT2464239	hsa-miR-4468	CLIP-seq
MIRT2464240	hsa-miR-4786-3p	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 29892012, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
620982	33722	ENSG00000187595

Q66K41

Protein name

Zinc finger protein 385C

Family and domains

Pfam

Accession	ID	Position in sequence	Type
PF12874	zf-met	78 → 103	Domain
PF12874	zf-met	223 → 247	Domain
PF12874	zf-met	292 → 316	Domain

Sequence

MLLGPASGAPSPLLASLPLPTRPLQPPLDFKHLLAFHFNGAAPLSLFPNFSTMDPVQKAV
ISHTFGVPSPLKKKLFISCNICHLRFNSANQAEAHYKGHKHARKLKAVEAAKSKQRPHTQ
AQDGAVVSPIPTLASGAPGEPQSKVPAAPPLGPPLQPPPTPDPTCREPAHSELLDAASSS
SSSSCPPCSPEPGREAPGPEPAAAAVGSSMSGEGRSEKGHLYCPTCKVTVNSASQLQAHN
TGAKHRWMMEGQRGAPRRSRGRPVSRGGAGHKAKRVTGGRGGRQGPSPAFHCALCQLQVN
SETQLKQHMSSRRHKDRLAGKTPKPSSQHSKLQKHAALAVSILKSKLALQKQLTKTLAAR
FLPSPLPTAATAICALPGPLALRPAPTAATTLFPAPILGPALFRTPAGAVRPATGPIVLA
PY

Sequence length

422

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ZNF385C (zinc finger protein 385C)