CENPV (centromere protein V)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
201161
Gene name Gene Name - the full gene name approved by the HGNC.
Centromere protein V
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CENPV
Synonyms (NCBI Gene) Gene synonyms aliases
3110013H01Rik, CENP-V, PRR6, p30
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p11.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(3)
miRTarBase ID miRNA Experiments Reference
MIRT032391 hsa-let-7b-5p Proteomics 18668040
MIRT049995 hsa-miR-28-5p CLASH 23622248
MIRT2198923 hsa-miR-4768-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(26)
GO ID Ontology Definition Evidence Reference
GO:0000776 Component Kinetochore IBA 21873635
GO:0000776 Component Kinetochore IDA 18772885
GO:0000777 Component Condensed chromosome kinetochore IEA
GO:0001667 Process Ameboidal-type cell migration IDA 19930468
GO:0003674 Function Molecular_function ND
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
608139 29920 ENSG00000166582
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q7Z7K6
Protein name Centromere protein V (CENP-V) (Nuclear protein p30) (Proline-rich protein 6)
Protein function Required for distribution of pericentromeric heterochromatin in interphase nuclei and for centromere formation and organization, chromosome alignment and cytokinesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04828 GFA 170 → 257 Glutathione-dependent formaldehyde-activating enzyme Domain
Sequence 
MRRSRSSAAAKLRGQKRSGASGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPP
SEKPRLRRSSPRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWET
FQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKK
QNRHFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHC
LDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSKE
Sequence length 275
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)		 22959728, 24931836
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis GWAS
Show/Hide Text Mining Associations (13)
Associations from Text Mining
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 22959728
Carcinoma Basal Cell Associate 31260673
Kidney Diseases Associate 209465
Leukemia Associate 37794021
Leukemia Lymphocytic Chronic B Cell Associate 6959750
Leukemia Myeloid Acute Associate 17431130, 20376080, 26053097, 30679799, 37794021
Lupus Erythematosus Systemic Associate 209465, 4372412
Lupus Nephritis Associate 209465
Neoplasms Stimulate 21427292
Poikiloderma with Neutropenia Associate 1867319