Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2011
Gene name Gene Name - the full gene name approved by the HGNC.
Microtubule affinity regulating kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MARK2
Synonyms (NCBI Gene) Gene synonyms aliases
EMK-1, EMK1, MRD76, PAR-1, Par-1b, Par1b
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inacti
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT048862 hsa-miR-93-5p CLASH 23622248
MIRT048691 hsa-miR-99a-5p CLASH 23622248
MIRT044813 hsa-miR-320a CLASH 23622248
MIRT041517 hsa-miR-193b-3p CLASH 23622248
MIRT437446 hsa-miR-190a-5p Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot 24009311
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000226 Process Microtubule cytoskeleton organization IBA
GO:0000287 Function Magnesium ion binding IDA 14976552
GO:0000422 Process Autophagy of mitochondrion NAS 24522549
GO:0001764 Process Neuron migration ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600526 3332 ENSG00000072518
Protein
UniProt ID Q7KZI7
Protein name Serine/threonine-protein kinase MARK2 (EC 2.7.11.1) (EC 2.7.11.26) (ELKL motif kinase 1) (EMK-1) (MAP/microtubule affinity-regulating kinase 2) (PAR1 homolog) (PAR1 homolog b) (Par-1b) (Par1b)
Protein function Serine/threonine-protein kinase (PubMed:23666762). Involved in cell polarity and microtubule dynamics regulation. Phosphorylates CRTC2/TORC2, DCX, HDAC7, KIF13B, MAP2, MAP4 and RAB11FIP2. Phosphorylates the microtubule-associated protein MAPT/TA
PDB 3IEC , 5EAK , 5KZ7 , 5KZ8 , 8TXY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 53 304 Protein kinase domain Domain
PF00627 UBA 324 360 UBA/TS-N domain Domain
PF02149 KA1 744 788 Kinase associated domain 1 Domain
Tissue specificity TISSUE SPECIFICITY: High levels of expression in heart, brain, skeletal muscle and pancreas, lower levels observed in lung, liver and kidney. {ECO:0000269|PubMed:9730619}.
Sequence
MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIG
KGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIE
TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAEN
LLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL
YTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMK
DRWM
NVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLL
LGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTS
NSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTST
NRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHP
NKASGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAG
QLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLSFRFARRNLNEPE
SKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDA
NSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIAS
KIANELKL
Sequence length 788
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
autism spectrum disorder Autism spectrum disorder N/A N/A ClinVar
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 21811019
Alzheimer Disease 15 Associate 16472737
Antiphospholipid Syndrome Associate 37901230
Attention Deficit Disorder with Hyperactivity Associate 32066674
Autistic Disorder Associate 35982159
Bipolar Disorder Associate 34953473
Carcinogenesis Associate 35743080
Carcinoma Non Small Cell Lung Associate 25907283, 36922348
Diabetes Mellitus Associate 18626018
Infections Associate 35743080