Gene Gene information from NCBI Gene database.
Entrez ID 2010
Gene name Emerin
Gene symbol EMD
Synonyms (NCBI Gene)
EDMDLEMD5STA
Chromosome X
Chromosome location Xq28
Summary Emerin is a serine-rich nuclear membrane protein and a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Dreifuss-Emery muscular dystrophy is an X-linked inherited degenerative myopathy resulting f
SNPs SNP information provided by dbSNP.
54
SNP ID Visualize variation Clinical significance Consequence
rs104894805 C>A,T Pathogenic, uncertain-significance Coding sequence variant, missense variant
rs104894806 C>A Pathogenic Coding sequence variant, missense variant
rs132630262 C>T Pathogenic Coding sequence variant, stop gained, 5 prime UTR variant
rs137977232 A>G Conflicting-interpretations-of-pathogenicity, uncertain-significance, benign-likely-benign Coding sequence variant, missense variant
rs139983160 C>T Likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
7
miRTarBase ID miRNA Experiments Reference
MIRT022307 hsa-miR-124-3p Microarray 18668037
MIRT023624 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT050333 hsa-miR-25-3p CLASH 23622248
MIRT049830 hsa-miR-92a-3p CLASH 23622248
MIRT046034 hsa-miR-125b-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
42
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IBA
GO:0003779 Function Actin binding IDA 15328537
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 11313760, 11587540, 12163176, 14597414, 15009215, 15328537, 15671068, 16169070, 16189514, 16858403, 17462627, 19323649, 19933576, 21346760, 21391237, 21610090, 22399800, 25416956, 25502805, 25910212, 27107012, 29568061, 30488537, 30833792, 31515488, 32296183, 32814053, 35271311
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300384 3331 ENSG00000102119
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P50402
Protein name Emerin
Protein function Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta-catenin activity by preventing its accumulation in
PDB 1JEI , 2ODC , 2ODG , 6GHD , 6RPR , 7NDY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03020 LEM 3 42 LEM domain Domain
Tissue specificity TISSUE SPECIFICITY: Skeletal muscle, heart, colon, testis, ovary and pancreas.
Sequence
MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYS
FSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQS
VTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLS
YYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLF
FIYHFMQAEEGNPF
Sequence length 254
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytoskeleton in muscle cells
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy
  Nuclear Envelope Breakdown
Initiation of Nuclear Envelope (NE) Reformation
Depolymerisation of the Nuclear Lamina
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
779
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cardiovascular phenotype Pathogenic rs2522788283, rs876661345, rs132630262 RCV002432875
RCV000246169
RCV002381248
Charcot-Marie-Tooth disease type 2 Likely pathogenic rs1557182214 RCV002221161
EMD-related disorder Pathogenic rs782452523 RCV003401269
Emery-Dreifuss muscular dystrophy Pathogenic; Likely pathogenic rs727503036, rs1557182301 RCV001280616
RCV001553580
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cardiomyopathy Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign rs2148128160, rs2067879183, rs782178894, rs139983160, rs2070818, rs782011714, rs398123157, rs1557182639, rs200537612, rs137977232, rs145985318, rs143447675, rs781840855, rs1569552110, rs781847968 RCV001799393
RCV001799394
RCV003150568
RCV000770590
RCV000853050
RCV003150155
RCV001798859
RCV000770592
RCV000770586
RCV000770588
RCV000770589
RCV000770591
RCV000770587
RCV000770593
RCV000852583
Cervical cancer Benign; Likely benign rs182540760 RCV005890767
Hypertrophic cardiomyopathy Uncertain significance rs2522790487 RCV003447916
Ovarian serous cystadenocarcinoma Benign; Likely benign rs182540760 RCV005890768
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 30542735, 36071546
Adenomatous Polyposis Coli Associate 16858403
Aneuploidy Associate 19581290
Arrhythmias Cardiac Associate 36106556
Atrial Fibrillation Associate 18266676
Atrial Remodeling Associate 31185657
Breast Neoplasms Associate 39198511
Cardiomyopathies Associate 24997722, 30506906
Cardiomyopathy Dilated Associate 30506906
Cardiovascular Abnormalities Associate 11063761