Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2010
Gene name Gene Name - the full gene name approved by the HGNC.
Emerin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EMD
Synonyms (NCBI Gene) Gene synonyms aliases
EDMD, LEMD5, STA
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq28
Summary Summary of gene provided in NCBI Entrez Gene.
Emerin is a serine-rich nuclear membrane protein and a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Dreifuss-Emery muscular dystrophy is an X-linked inherited degenerative myopathy resulting f
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894805 C>A,T Pathogenic, uncertain-significance Coding sequence variant, missense variant
rs104894806 C>A Pathogenic Coding sequence variant, missense variant
rs132630262 C>T Pathogenic Coding sequence variant, stop gained, 5 prime UTR variant
rs137977232 A>G Conflicting-interpretations-of-pathogenicity, uncertain-significance, benign-likely-benign Coding sequence variant, missense variant
rs139983160 C>T Likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022307 hsa-miR-124-3p Microarray 18668037
MIRT023624 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT050333 hsa-miR-25-3p CLASH 23622248
MIRT049830 hsa-miR-92a-3p CLASH 23622248
MIRT046034 hsa-miR-125b-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IBA
GO:0003779 Function Actin binding IDA 15328537
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 11313760, 11587540, 12163176, 14597414, 15009215, 15328537, 15671068, 16169070, 16189514, 16858403, 17462627, 19323649, 19933576, 21346760, 21391237, 21610090, 22399800, 25416956, 25502805, 25910212, 27107012, 29568061, 30488537, 30833792, 31515488, 32296183, 32814053, 35271311
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300384 3331 ENSG00000102119
Protein
UniProt ID P50402
Protein name Emerin
Protein function Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta-catenin activity by preventing its accumulation in
PDB 1JEI , 2ODC , 2ODG , 6GHD , 6RPR , 7NDY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03020 LEM 3 42 LEM domain Domain
Tissue specificity TISSUE SPECIFICITY: Skeletal muscle, heart, colon, testis, ovary and pancreas.
Sequence
MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYS
FSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQS
VTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLS
YYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLF
FIYHFMQAEEGNPF
Sequence length 254
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytoskeleton in muscle cells
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy
  Nuclear Envelope Breakdown
Initiation of Nuclear Envelope (NE) Reformation
Depolymerisation of the Nuclear Lamina
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cardiomyopathy Primary familial dilated cardiomyopathy rs1603365762 N/A
emery-dreifuss muscular dystrophy Emery-Dreifuss muscular dystrophy rs727503036, rs1557182301 N/A
Emery-Dreifuss Muscular Dystrophy, X-Linked x-linked emery-dreifuss muscular dystrophy, Emery-Dreifuss muscular dystrophy 1, X-linked rs1557182611, rs2067873691, rs398123158, rs886044901, rs1557182364, rs2067883871, rs1060502612, rs1557182301, rs727504901, rs727503036, rs1557182286, rs730880352, rs1557182661, rs1557182654, rs1422834817
View all (20 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypertrophic Cardiomyopathy Primary familial hypertrophic cardiomyopathy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 30542735, 36071546
Adenomatous Polyposis Coli Associate 16858403
Aneuploidy Associate 19581290
Arrhythmias Cardiac Associate 36106556
Atrial Fibrillation Associate 18266676
Atrial Remodeling Associate 31185657
Breast Neoplasms Associate 39198511
Cardiomyopathies Associate 24997722, 30506906
Cardiomyopathy Dilated Associate 30506906
Cardiovascular Abnormalities Associate 11063761