Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	200909
Gene name Gene Name - the full gene name approved by the HGNC.	5-hydroxytryptamine receptor 3D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HTR3D
Synonyms (NCBI Gene) Gene synonyms aliases	5HT3D
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q27.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit D of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a mitogen and a ho

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments
MIRT1057259	hsa-miR-3151	CLIP-seq
MIRT1057260	hsa-miR-3689a-3p	CLIP-seq
MIRT1057261	hsa-miR-3689c	CLIP-seq
MIRT1057262	hsa-miR-4283	CLIP-seq
MIRT1057263	hsa-miR-4446-3p	CLIP-seq
MIRT1057264	hsa-miR-4481	CLIP-seq
MIRT1057265	hsa-miR-4489	CLIP-seq
MIRT1057266	hsa-miR-4656	CLIP-seq
MIRT1057267	hsa-miR-4721	CLIP-seq
MIRT1057268	hsa-miR-4728-5p	CLIP-seq
MIRT1057269	hsa-miR-4745-5p	CLIP-seq
MIRT1057270	hsa-miR-4758-5p	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17392525
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007210	Process	Serotonin receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	TAS
GO:0022850	Function	Serotonin-gated cation-selective channel activity	IBA	21873635
GO:0022850	Function	Serotonin-gated cation-selective channel activity	IDA	17392525
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0034220	Process	Ion transmembrane transport	IBA	21873635
GO:0042391	Process	Regulation of membrane potential	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0045202	Component	Synapse	IBA	21873635
GO:0050877	Process	Nervous system process	IBA	21873635

MIM	HGNC	e!Ensembl
610122	24004	ENSG00000186090

Protein

UniProt ID

Q70Z44

Protein name

5-hydroxytryptamine receptor 3D (5-HT3-D) (5-HT3D) (Serotonin receptor 3D)

Protein function

Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	44 → 151	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	236 → 431	Neurotransmitter-gated ion-channel transmembrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in liver, as well as fetal and adult colon and kidney. {ECO:0000269|PubMed:12801637}.

Sequence

MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYS
VATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLS
DVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRS
FQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPS
GILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALM
QTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCP
TAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE
LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT

Sequence length

454

Interactions

View interactions

	KEGG		Reactome
	Serotonergic synapse Taste transduction		Neurotransmitter receptors and postsynaptic signal transmission

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	20356718

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Dyspepsia	Associate	21192076
Irritable Bowel Syndrome	Associate	21192076
Obsessive Compulsive Disorder	Associate	27616601

HTR3D (5-hydroxytryptamine receptor 3D)