HTR3D (5-hydroxytryptamine receptor 3D)

Gene

• Entrez ID: 200909
• Gene name: 5-hydroxytryptamine receptor 3D
• Gene symbol: HTR3D
• Synonyms (NCBI Gene): 5HT3D
• Chromosome: 3
• Chromosome location: 3q27.1
• Summary: The protein encoded this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit D of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a mitogen and a ho

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1057259	hsa-miR-3151	CLIP-seq
MIRT1057260	hsa-miR-3689a-3p	CLIP-seq
MIRT1057261	hsa-miR-3689c	CLIP-seq
MIRT1057262	hsa-miR-4283	CLIP-seq
MIRT1057263	hsa-miR-4446-3p	CLIP-seq
MIRT1057264	hsa-miR-4481	CLIP-seq
MIRT1057265	hsa-miR-4489	CLIP-seq
MIRT1057266	hsa-miR-4656	CLIP-seq
MIRT1057267	hsa-miR-4721	CLIP-seq
MIRT1057268	hsa-miR-4728-5p	CLIP-seq
MIRT1057269	hsa-miR-4745-5p	CLIP-seq
MIRT1057270	hsa-miR-4758-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005231	Function	Excitatory extracellular ligand-gated monoatomic ion channel activity	IBA
GO:0005515	Function	Protein binding	IPI	17392525
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17392525
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007210	Process	Serotonin receptor signaling pathway	IDA	17392525
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0016020	Component	Membrane	IEA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IBA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IDA	17392525
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042391	Process	Regulation of membrane potential	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IDA	17392525
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IBA
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IDA	17392525
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IEA
GO:1902495	Component	Transmembrane transporter complex	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IBA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IEA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IPI	17392525

Other IDs

• MIM: 610122
• HGNC: 24004
• e!Ensembl: ENSG00000186090

Protein

• UniProt ID: Q70Z44
• Protein name: 5-hydroxytryptamine receptor 3D (5-HT3-D) (5-HT3D) (Serotonin receptor 3D)
• Protein function: Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02931	Neur_chan_LBD	44 → 151	Neurotransmitter-gated ion-channel ligand binding domain	Family
  PF02932	Neur_chan_memb	236 → 431	Neurotransmitter-gated ion-channel transmembrane region	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in liver, as well as fetal and adult colon and kidney. {ECO:0000269|PubMed:12801637}.
• Sequence:

  MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYS
  VATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLS
  DVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRS
  FQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPS
  GILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALM
  QTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCP
  TAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE
  LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT

• Sequence length: 454

Pathways

KEGG:

Serotonergic synapse
Taste transduction

Reactome:

Neurotransmitter receptors and postsynaptic signal transmission