Gene Gene information from NCBI Gene database.
Entrez ID 200734
Gene name Sprouty related EVH1 domain containing 2
Gene symbol SPRED2
Synonyms (NCBI Gene)
NS14Spred-2
Chromosome 2
Chromosome location 2p14
Summary SPRED2 is a member of the Sprouty (see SPRY1; MIM 602465)/SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade (see MAPK1; MIM 176948) (Nonami et al., 2004 [PubMed 15465815]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
293
miRTarBase ID miRNA Experiments Reference
MIRT021167 hsa-miR-186-5p Sequencing 20371350
MIRT569487 hsa-miR-6776-3p PAR-CLIP 20371350
MIRT569485 hsa-miR-4715-5p PAR-CLIP 20371350
MIRT569486 hsa-miR-1914-5p PAR-CLIP 20371350
MIRT569484 hsa-miR-192-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0005173 Function Stem cell factor receptor binding ISS
GO:0005515 Function Protein binding IPI 19822672, 24705354, 25416956, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781, 34626534
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609292 17722 ENSG00000198369
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z698
Protein name Sprouty-related, EVH1 domain-containing protein 2 (Spred-2)
Protein function Negatively regulates Ras signaling pathways and downstream activation of MAP kinases (PubMed:15683364, PubMed:34626534). Recruits and translocates NF1 to the cell membrane, thereby enabling NF1-dependent hydrolysis of active GTP-bound Ras to ina
PDB 2JP2 , 8EQ5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00568 WH1 7 119 WH1 domain Domain
PF05210 Sprouty 306 415 Sprouty protein (Spry) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in liver, skin, small intestine, salivary gland and prostate. {ECO:0000269|PubMed:15580519}.
Sequence
MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIH
GERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAI
E
DLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTL
GHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKY
PDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSRRR
KEDGERSRCVYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGD
YTDPCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHK
AAA
Sequence length 418
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of RAS by GAPs
FGFRL1 modulation of FGFR1 signaling
RAS signaling downstream of NF1 loss-of-function variants
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Noonan syndrome Pathogenic rs2104102138, rs2104216988, rs780902942 RCV001720326
RCV001720327
RCV001580210
Noonan syndrome 14 Pathogenic rs2104102138, rs2104216988, rs780902942 RCV001836617
RCV001836618
RCV001836619
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Severe postnatal growth retardation Uncertain significance rs2528767246 RCV003223495
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Inhibit 39580880
Adenocarcinoma in Situ Inhibit 39580880
Adenocarcinoma of Lung Associate 39580880
Arthritis Rheumatoid Associate 32831971, 36924774, 36973646
Arthritis Rheumatoid Inhibit 36924774
Carcinogenesis Associate 34818323
Carcinoma Ductal Breast Inhibit 34818323
Carcinoma Hepatocellular Associate 36902429
Carcinoma in Situ Inhibit 34818323
Carcinoma Papillary Inhibit 34818323