Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
200734
Gene name Gene Name - the full gene name approved by the HGNC.
Sprouty related EVH1 domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPRED2
Synonyms (NCBI Gene) Gene synonyms aliases
NS14, Spred-2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
NS14
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p14
Summary Summary of gene provided in NCBI Entrez Gene.
SPRED2 is a member of the Sprouty (see SPRY1; MIM 602465)/SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade (see MAPK1; MIM 176948) (Nonami et al., 2004 [PubMed 15465815]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021167 hsa-miR-186-5p Sequencing 20371350
MIRT569487 hsa-miR-6776-3p PAR-CLIP 20371350
MIRT569485 hsa-miR-4715-5p PAR-CLIP 20371350
MIRT569486 hsa-miR-1914-5p PAR-CLIP 20371350
MIRT569484 hsa-miR-192-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000188 Process Inactivation of MAPK activity IBA 21873635
GO:0000188 Process Inactivation of MAPK activity ISS
GO:0005173 Function Stem cell factor receptor binding ISS
GO:0005515 Function Protein binding IPI 19822672, 24705354, 25416956, 28514442, 29892012, 31515488, 32296183, 32814053
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609292 17722 ENSG00000198369
Protein
UniProt ID Q7Z698
Protein name Sprouty-related, EVH1 domain-containing protein 2 (Spred-2)
Protein function Negatively regulates Ras signaling pathways and downstream activation of MAP kinases (PubMed:15683364, PubMed:34626534). Recruits and translocates NF1 to the cell membrane, thereby enabling NF1-dependent hydrolysis of active GTP-bound Ras to ina
PDB 2JP2 , 8EQ5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00568 WH1 7 119 WH1 domain Domain
PF05210 Sprouty 306 415 Sprouty protein (Spry) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in liver, skin, small intestine, salivary gland and prostate. {ECO:0000269|PubMed:15580519}.
Sequence
MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIH
GERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAI
E
DLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTL
GHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKY
PDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSRRR
KEDGERSRCVYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGD
YTDPCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHK
AAA
Sequence length 418
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of RAS by GAPs
FGFRL1 modulation of FGFR1 signaling
RAS signaling downstream of NF1 loss-of-function variants
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Alzheimer`s Disease rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)
26830138
Autoimmune diseases Autoimmune Diseases rs869025224 21383967
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)
22190364
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 23143596, 20453842, 24782177, 30423114, 24532676, 24390342, 22446963
Unknown
Disease term Disease name Evidence References Source
Noonan Syndrome Noonan syndrome 14 GenCC
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Diabetes Diabetes GWAS
Coronary artery disease Coronary artery disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Inhibit 39580880
Adenocarcinoma in Situ Inhibit 39580880
Adenocarcinoma of Lung Associate 39580880
Arthritis Rheumatoid Associate 32831971, 36924774, 36973646
Arthritis Rheumatoid Inhibit 36924774
Carcinogenesis Associate 34818323
Carcinoma Ductal Breast Inhibit 34818323
Carcinoma Hepatocellular Associate 36902429
Carcinoma in Situ Inhibit 34818323
Carcinoma Papillary Inhibit 34818323