Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
200558
Gene name Gene Name - the full gene name approved by the HGNC.
Aprataxin and PNKP like factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
APLF
Synonyms (NCBI Gene) Gene synonyms aliases
APFL, C2orf13, PALF, Xip1, ZCCHH1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
C2ORF13 is a component of the cellular response to chromosomal DNA single- and double-strand breaks (Iles et al., 2007 [PubMed 17353262]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT660598 hsa-miR-4724-5p HITS-CLIP 23824327
MIRT660597 hsa-miR-3613-3p HITS-CLIP 23824327
MIRT660596 hsa-miR-3065-5p HITS-CLIP 23824327
MIRT660594 hsa-miR-4708-3p HITS-CLIP 23824327
MIRT660595 hsa-miR-196a-3p HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
ATM Unknown 18077224
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000012 Process Single strand break repair IMP 17396150
GO:0000166 Function Nucleotide binding IDA 18172500
GO:0000166 Function Nucleotide binding IEA
GO:0003906 Function DNA-(apurinic or apyrimidinic site) endonuclease activity IBA
GO:0003906 Function DNA-(apurinic or apyrimidinic site) endonuclease activity IDA 17396150
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611035 28724 ENSG00000169621
Protein
UniProt ID Q8IW19
Protein name Aprataxin and PNK-like factor (EC 3.1.-.-) (Apurinic-apyrimidinic endonuclease APLF) (PNK and APTX-like FHA domain-containing protein) (XRCC1-interacting protein 1)
Protein function Histone chaperone involved in single-strand and double-strand DNA break repair (PubMed:17353262, PubMed:17396150, PubMed:21211721, PubMed:21211722, PubMed:29905837, PubMed:30104678). Recruited to sites of DNA damage through interaction with bran
PDB 2KQB , 2KQC , 2KQD , 2KQE , 2KUO , 5E50 , 5W7W , 5W7X , 5W7Y , 6ERF , 6TYT , 6TYW , 6TYZ , 6YN1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17913 FHA_2 8 101 FHA domain Domain
PF10283 zf-CCHH 376 401 PBZ domain Domain
PF10283 zf-CCHH 418 444 PBZ domain Domain
Sequence
MSGGFELQPRDGGPRVALAPGETVIGRGPLLGITDKRVSRRHAILEVAGGQLRIKPIHTN
PCFYQSSEKSQLLPLKPNLWCYLNPGDSFSLLVDKYIFRIL
SIPSEVEMQCTLRNSQVLD
EDNILNETPKSPVINLPHETTGASQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILA
ERKRILPTWMLAEHLSDQNLSVPAISGGNVIQGSGKEEICKDKSQLNTTQQGRRQLISSG
SSENTSAEQDTGEECKNTDQEESTISSKEMPQSFSAITLSNTEMNNIKTNAQRNKLPIEE
LGKVSKHKIATKRTPHKEDEAMSCSENCSSAQGDSLQDESQGSHSESSSNPSNPETLHAK
ATDSVLQGSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPE
CPYGPSCYRKNPQHKIEYRHNTLP
VRNVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTD
EDSDWEPGKEDEEKEDVEELLKEAKRFMKRK
Sequence length 511
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ischemic Stroke Ischemic stroke N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Urinary Bladder Neoplasms Associate 31287003