Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
200539
Gene name Gene Name - the full gene name approved by the HGNC.
Ankyrin repeat domain 23
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ANKRD23
Synonyms (NCBI Gene) Gene synonyms aliases
DARP, MARP3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the muscle ankyrin repeat protein (MARP) family and encodes a protein with four tandem ankyrin-like repeats. The protein is localized to the nucleus, functioning as a transcriptional regulator. Expression of this protein is induce
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT509717 hsa-miR-6753-5p PAR-CLIP 23446348
MIRT509716 hsa-miR-6502-3p PAR-CLIP 23446348
MIRT509715 hsa-miR-6510-5p PAR-CLIP 23446348
MIRT509714 hsa-miR-4733-3p PAR-CLIP 23446348
MIRT509713 hsa-miR-4270 PAR-CLIP 23446348
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000976 Function Transcription cis-regulatory region binding IBA
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610736 24470 ENSG00000163126
Protein
UniProt ID Q86SG2
Protein name Ankyrin repeat domain-containing protein 23 (Diabetes-related ankyrin repeat protein) (Muscle ankyrin repeat protein 3)
Protein function May be involved in the energy metabolism. Could be a molecular link between myofibrillar stretch-induced signaling pathways and muscle gene expression.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 114 207 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 155 240 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 208 273 Ankyrin repeats (3 copies) Repeat
Tissue specificity TISSUE SPECIFICITY: Mainly expressed in heart, skeletal muscle and brown adipose tissues. {ECO:0000269|PubMed:12456686}.
Sequence
MDFISIQQLVSGERVEGKVLGFGHGVPDPGAWPSDWRRGPQEAVAREKLKLEEEKKKKLE
RFNSTRFNLDNLADLENLVQRRKKRLRHRVPPRKPEPLVKPQSQAQVEPVGLEMFLKAAA
ENQEYLIDKYLTDGGDPNAHDKLHRTALHWACLK
GHSQLVNKLLVAGATVDARDLLDRTP
VFWACRGGHLVILKQLLNQGARVNARD
KIGSTPLHVAVRTRHPDCLEHLIECGAHLNAQD
KEGDTALHEAVRHGSYKAMKLLLLYGAELGVRN
AASVTPVQLARDWQRGIREALQAHVAH
PRTRC
Sequence length 305
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Cytoskeleton in muscle cells  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bipolar Disorder Bipolar I disorder N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS