Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2004
Gene name Gene Name - the full gene name approved by the HGNC.
ETS transcription factor ELK3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ELK3
Synonyms (NCBI Gene) Gene synonyms aliases
ERP, NET, SAP-2, SAP2
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This pro
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003523 hsa-miR-124-3p Luciferase reporter assay 20144220
MIRT003178 hsa-miR-210-3p immunoprecipitaion, Microarray, qRT-PCR 19826008
MIRT016563 hsa-miR-193b-3p Microarray 20304954
MIRT020463 hsa-miR-106b-5p Microarray 17242205
MIRT003523 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 12788937
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600247 3325 ENSG00000111145
Protein
UniProt ID P41970
Protein name ETS domain-containing protein Elk-3 (ETS-related protein ERP) (ETS-related protein NET) (Serum response factor accessory protein 2) (SAP-2) (SRF accessory protein 2)
Protein function May be a negative regulator of transcription, but can activate transcription when coexpressed with Ras, Src or Mos. Forms a ternary complex with the serum response factor and the ETS and SRF motifs of the Fos serum response element.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00178 Ets 6 85 Ets-domain Domain
Sequence
MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLS
RALRYYYDKNIIKKVIGQKFVYKFV
SFPEILKMDPHAVEISRESLLLQDSDCKASPEGRE
AHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVR
TVIRFVTNKTDKHVTRPVVSLPSTSEAAAASAFLASSVSAKISSLMLPNAASISSASPFS
SRSPSLSPNSPLPSEHRSLFLEAACHDSDSLEPLNLSSGSKTKSPSLPPKAKKPKGLEIS
APPLVLSGTDIGSIALNSPALPSGSLTPAFFTAQTPNGLLLTPSPLLSSIHFWSSLSPVA
PLSPARLQGPSTLFQFPTLLNGHMPVPIPSLDRAASPVLLSSNSQKS
Sequence length 407
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
16583263
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
16583263
Lymphoblastic leukemia Precursor B-Cell Lymphoblastic Leukemia-Lymphoma rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699
View all (13 more)
29632299, 27694927
Marfan syndrome Mammary Carcinoma, Human rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465
View all (942 more)
16583263
Unknown
Disease term Disease name Evidence References Source
Heart failure Heart Failure, Diastolic 29556499 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Aortic Aneurysm Abdominal Associate 37822152
Breast Neoplasms Inhibit 17172821
Breast Neoplasms Associate 26637400, 31511359, 36950218
Carcinoma Squamous Cell Associate 26590320
Colorectal Neoplasms Associate 32571262
Combined Saposin Deficiency Associate 2060627
Gaucher Disease Associate 2060627
Glioma Associate 35905257
Hemoglobin SC Disease Associate 26590320
Hypoxia Stimulate 37394639