A2M (alpha-2-macroglobulin)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2
Gene name Gene Name - the full gene name approved by the HGNC.
Alpha-2-macroglobulin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
A2M
Synonyms (NCBI Gene) Gene synonyms aliases
A2MD, CPAMD5, FWP007, S863-7
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a protease inhibitor and cytokine transporter. It uses a bait-and-trap mechanism to inhibit a broad spectrum of proteases, including trypsin, thrombin and collagenase. It can also inhibit inflammatory cytokines, and it
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
miRTarBase ID miRNA Experiments Reference
MIRT021948 hsa-miR-128-3p Microarray 17612493
MIRT023224 hsa-miR-122-5p Microarray 17612493
MIRT027430 hsa-miR-98-5p Microarray 19088304
MIRT736703 hsa-miR-146b-5p Luciferase reporter assay, Western blotting, qRT-PCR, ELISA 31422941
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
NFKB1 Unknown 11466367
STAT3 Unknown 11466367
TFCP2 Unknown 10455131
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(28)
GO ID Ontology Definition Evidence Reference
GO:0001869 Process Negative regulation of complement activation, lectin pathway IDA 12538697
GO:0002020 Function Protease binding IBA 21873635
GO:0002020 Function Protease binding IPI 18485748
GO:0002576 Process Platelet degranulation TAS
GO:0004866 Function Endopeptidase inhibitor activity IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
103950 7 ENSG00000175899
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P01023
Protein name Alpha-2-macroglobulin (Alpha-2-M) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5)
Protein function Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bai
PDB 1BV8 , 2P9R , 6TAV , 7O7L , 7O7M , 7O7N , 7O7O , 7O7P , 7O7Q , 7O7R , 7O7S , 7VON , 7VOO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01835 MG2 128 → 221 MG2 domain Domain
PF17791 MG3 223 → 313 Macroglobulin domain MG3 Domain
PF17789 MG4 350 → 445 Macroglobulin domain MG4 Domain
PF07703 A2M_BRD 459 → 607 Alpha-2-macroglobulin bait region domain Domain
PF00207 A2M 738 → 828 Alpha-2-macroglobulin family Family
PF07678 TED_complement 948 → 1264 A-macroglobulin TED domain Domain
PF07677 A2M_recep 1376 → 1463 A-macroglobulin receptor binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Secreted in plasma. {ECO:0000269|PubMed:6203908}.
Sequence 
MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTV
SASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTV
MVKNEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQS
FQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLPKFEVQVTVPKIIT
ILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCF
YQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRTITKLSFVKVDSHFR
QGIPFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQFSINTTNVMGTSLT
VRVNYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVHLEPMSHELPCGHTQTVQAHY
ILNGGTLLGLKKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGHFSISIPVKSDIAPVARL
LIYAVLPTGDVIGDSAKYDVENCLANKVDLSFSPSQSLPASHAHLRVTAAPQSVCALRAV
DQSVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDNEDCINRHNVYINGITYTPVSS
TNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARL
VHVEEPHTETVRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGI
SSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVE
KEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVI
KPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQ
NTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKH
YDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCF
RSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVTHPVVRNALFCLESAWKTAQEGDH
GSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQ
APSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHA
LSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEYSMKVTGEG
CVYLQTSLKYNILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAI
VDVKMVSGFIPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
DLKPAIVKVYDYYETDEFAIAEYNAPCSKDLGNA
Sequence length 1474
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Complement and coagulation cascades   Platelet degranulation
Intrinsic Pathway of Fibrin Clot Formation
Degradation of the extracellular matrix
Rho GTPase cycle
HDL assembly
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (5)
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)		 15023809, 9811940, 9697696
Colonic neoplasms Malignant tumor of colon, Colonic Neoplasms rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 15059925
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 17902193, 19180532
Nephrotic syndrome Nephrotic Syndrome rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910
View all (152 more)		 11304663
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Mental depression Mental Depression, Depressive disorder 2432615, 11058789 ClinVar
Show/Hide Text Mining Associations (73)
Associations from Text Mining
Disease Name Relationship Type References
Acute Kidney Injury Associate 33801801
Alzheimer Disease Associate 10688047, 11058432, 11106172, 18842138, 19105203, 29154276, 34958020, 35387811, 9837937
Alzheimer Disease Stimulate 27872486, 35456941
Anemia Sickle Cell Associate 20561980
Aortic Aneurysm Abdominal Inhibit 11854734
Aortic Aneurysm Abdominal Associate 27934969
Arthritis Rheumatoid Associate 2510617, 34788409
Atherosclerosis Associate 33086557
Autism Spectrum Disorder Stimulate 33187600
Brain Diseases Associate 35456941