CYP4Z1 (cytochrome P450 family 4 subfamily Z member 1)

Gene

• Entrez ID: 199974
• Gene name: Cytochrome P450 family 4 subfamily Z member 1
• Gene symbol: CYP4Z1
• Synonyms (NCBI Gene): CYP4A20
• Chromosome: 1
• Chromosome location: 1p33
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT921792	hsa-miR-2467-3p	CLIP-seq
MIRT921793	hsa-miR-2681	CLIP-seq
MIRT921794	hsa-miR-3145-3p	CLIP-seq
MIRT921795	hsa-miR-3678-3p	CLIP-seq
MIRT921796	hsa-miR-4756-3p	CLIP-seq
MIRT921797	hsa-miR-577	CLIP-seq
MIRT2512543	hsa-miR-410	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	15059886
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0008404	Function	Arachidonate 14,15-epoxygenase activity	IDA	29018033
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0019369	Process	Arachidonate metabolic process	IDA	29018033
GO:0020037	Function	Heme binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048252	Process	Lauric acid metabolic process	IDA	19090726, 29018033
GO:0052722	Function	Fatty acid in-chain hydroxylase activity	IDA	19090726, 29018033
GO:0052722	Function	Fatty acid in-chain hydroxylase activity	IEA

Other IDs

• MIM: 618953
• HGNC: 20583
• e!Ensembl: ENSG00000186160

Protein

• UniProt ID: Q86W10
• Protein name: Cytochrome P450 4Z1 (EC 1.14.14.1) (CYPIVZ1) (Laurate 7-monooxygenase) (EC 1.14.14.130)
• Protein function: A cytochrome P450 monooxygenase that catalyzes the in-chain oxidation of fatty acids (PubMed:19090726, PubMed:29018033). Catalyzes the hydroxylation of carbon-hydrogen bonds. Hydroxylates lauric and myristic acids predominantly at the omega-4 an
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	47 → 500	Cytochrome P450	Domain

• Tissue specificity: TISSUE SPECIFICITY: Preferentially detected in breast carcinoma tissue and mammary gland, whereas only marginal expression is found in all other tested tissues. {ECO:0000269|PubMed:15059886}.
• Sequence:

  MEPSWLQELMAHPFLLLILLCMSLLLFQVIRLYQRRRWMIRALHLFPAPPAHWFYGHKEF
  YPVKEFEVYHKLMEKYPCAVPLWVGPFTMFFSVHDPDYAKILLKRQDPKSAVSHKILESW
  VGRGLVTLDGSKWKKHRQIVKPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELF
  QHVSLMTLDSIMKCAFSHQGSIQLDSTLDSYLKAVFNLSKISNQRMNNFLHHNDLVFKFS
  SQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKRRWDFLDILLSAKSENTKDFS
  EADLQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGDGSSITWEHLS
  QMPYTTMCIKECLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWED
  PQVFNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAPDHS
  RPPQPVRQVVLKSKNGIHVFAKKVC

• Sequence length: 505

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary disease, chronic obstructive, susceptibility to	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Inhibit	28236635	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Associate	29018033, 39958347	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Associate	34590601, 35401882, 35906899, 36143940	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	36143940	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Stimulate	33692504	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	34590601	★☆☆☆☆ Found in Text Mining only