ELAVL4 (ELAV like RNA binding protein 4)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1996
Gene name Gene Name - the full gene name approved by the HGNC.
ELAV like RNA binding protein 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ELAVL4
Synonyms (NCBI Gene) Gene synonyms aliases
HUD, PNEM
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p33-p32.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(49)
miRTarBase ID miRNA Experiments Reference
MIRT005543 hsa-miR-375 GFP reporter assay, Immunohistochemistry, Microarray, qRT-PCR, Western blot 20584986
MIRT005543 hsa-miR-375 GFP reporter assay, Immunohistochemistry, Microarray, qRT-PCR, Western blot 20584986
MIRT005543 hsa-miR-375 Reporter assay;Western blot;qRT-PCR;Microarray;Other 20584986
MIRT021646 hsa-miR-141-3p qRT-PCR 20584986
MIRT030948 hsa-miR-21-5p qRT-PCR 20584986
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0003730 Function MRNA 3'-UTR binding IDA 12468554, 18218628
GO:0005737 Component Cytoplasm ISS
GO:0006396 Process RNA processing IDA 17035636
GO:0006397 Process MRNA processing IEA
GO:0008143 Function Poly(A) binding IDA 12034726
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
168360 3315 ENSG00000162374
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID P26378
Protein name ELAV-like protein 4 (Hu-antigen D) (HuD) (Paraneoplastic encephalomyelitis antigen HuD)
Protein function RNA-binding protein that is involved in the post-transcriptional regulation of mRNAs (PubMed:10710437, PubMed:12034726, PubMed:12468554, PubMed:17035636, PubMed:17234598, PubMed:7898713). Plays a role in the regulation of mRNA stability, alterna
PDB 1FXL , 1G2E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 53 → 123 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 139 → 207 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 304 → 374 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in pancreatic beta cells (at protein level) (PubMed:22387028). Expressed in the brain (PubMed:14702039, PubMed:1655278). {ECO:0000269|PubMed:14702039, ECO:0000269|PubMed:1655278, ECO:0000269|PubMed:22387028}.
Sequence 
MEWNGLKMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQ
NMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTK
TIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGV
GFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPG
PLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGT
GWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAI
ASLNGYRLGDRVLQVSFKTNKAHKS
Sequence length 385
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 28991256, 30285260
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Mental depression Major Depressive Disorder 30718901 ClinVar
Show/Hide Text Mining Associations (11)
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 35843356
Amyotrophic Lateral Sclerosis Associate 31242416
Colorectal Neoplasms Associate 22011044
Epilepsy Associate 34588521
Hemangioma Cavernous Central Nervous System Associate 34588521
Neoplasms Associate 22011044
Neoplasms Adipose Tissue Associate 28767316
Nerve Degeneration Associate 34314701
Obesity Associate 28767316
Parkinson Disease Associate 18587682, 24156912