ELAVL4 (ELAV like RNA binding protein 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 1996
Gene name ELAV like RNA binding protein 4
Gene symbol ELAVL4
Synonyms (NCBI Gene)
HUDPNEM
Chromosome 1
Chromosome location 1p33-p32.3
miRNA miRNA information provided by mirtarbase database.
49
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (49)
miRTarBase ID miRNA Experiments Reference
MIRT005543 hsa-miR-375 GFP reporter assayImmunohistochemistryMicroarrayqRT-PCRWestern blot 20584986
MIRT005543 hsa-miR-375 GFP reporter assayImmunohistochemistryMicroarrayqRT-PCRWestern blot 20584986
MIRT005543 hsa-miR-375 Reporter assay;Western blot;qRT-PCR;Microarray;Other 20584986
MIRT021646 hsa-miR-141-3p qRT-PCR 20584986
MIRT030948 hsa-miR-21-5p qRT-PCR 20584986
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (30)
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IEA
GO:0003730 Function MRNA 3'-UTR binding IDA 12468554, 18218628
GO:0003730 Function MRNA 3'-UTR binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
168360 3315 ENSG00000162374
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P26378
Protein name ELAV-like protein 4 (Hu-antigen D) (HuD) (Paraneoplastic encephalomyelitis antigen HuD)
Protein function RNA-binding protein that is involved in the post-transcriptional regulation of mRNAs (PubMed:10710437, PubMed:12034726, PubMed:12468554, PubMed:17035636, PubMed:17234598, PubMed:7898713). Plays a role in the regulation of mRNA stability, alterna
PDB 1FXL , 1G2E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 53 → 123 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 139 → 207 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 304 → 374 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in pancreatic beta cells (at protein level) (PubMed:22387028). Expressed in the brain (PubMed:14702039, PubMed:1655278). {ECO:0000269|PubMed:14702039, ECO:0000269|PubMed:1655278, ECO:0000269|PubMed:22387028}.
Sequence 
MEWNGLKMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQ
NMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTK
TIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGV
GFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPG
PLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGT
GWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAI
ASLNGYRLGDRVLQVSFKTNKAHKS
Sequence length 385
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
High myopia Uncertain significance rs116391279 RCV000785703
Show/Hide Text Mining Associations (11)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 35843356
Amyotrophic Lateral Sclerosis Associate 31242416
Colorectal Neoplasms Associate 22011044
Epilepsy Associate 34588521
Hemangioma Cavernous Central Nervous System Associate 34588521
Neoplasms Associate 22011044
Neoplasms Adipose Tissue Associate 28767316
Nerve Degeneration Associate 34314701
Obesity Associate 28767316
Parkinson Disease Associate 18587682, 24156912