Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1994
Gene name Gene Name - the full gene name approved by the HGNC.	ELAV like RNA binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ELAVL1
Synonyms (NCBI Gene) Gene synonyms aliases	ELAV1, HUR, Hua, MelG
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the ELAVL family of RNA-binding proteins that contain several RNA recognition motifs, and selectively bind AU-rich elements (AREs) found in the 3` untranslated regions of mRNAs. AREs signal degradation of mR

Show/Hide all(306)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003731	hsa-miR-519b-3p	qRT-PCR, Western blot	19088191
MIRT003731	hsa-miR-519b-3p	qRT-PCR, Western blot	19088191
MIRT003732	hsa-miR-519c-3p	qRT-PCR, Western blot	19088191
MIRT003732	hsa-miR-519c-3p	qRT-PCR, Western blot	19088191
MIRT003733	hsa-miR-519a-3p	qRT-PCR, Western blot	19088191
MIRT003733	hsa-miR-519a-3p	qRT-PCR, Western blot	19088191
MIRT003731	hsa-miR-519b-3p	Western blot	19088191
MIRT003731	hsa-miR-519b-3p	qRT-PCR	19088191
MIRT003732	hsa-miR-519c-3p	Western blot	19088191
MIRT003732	hsa-miR-519c-3p	qRT-PCR	19088191
MIRT003733	hsa-miR-519a-3p	Western blot	19088191
MIRT003733	hsa-miR-519a-3p	qRT-PCR	19088191
MIRT003731	hsa-miR-519b-3p	Western blot	19088191
MIRT003731	hsa-miR-519b-3p	qRT-PCR	19088191
MIRT003732	hsa-miR-519c-3p	Western blot	19088191
MIRT003732	hsa-miR-519c-3p	qRT-PCR	19088191
MIRT003733	hsa-miR-519a-3p	qRT-PCR, Western blot	19088191
MIRT003733	hsa-miR-519a-3p	qRT-PCR	19088191
MIRT005421	hsa-miR-125a-5p	Luciferase reporter assay, Western blot	19875930
MIRT019606	hsa-miR-340-5p	Sequencing	20371350
MIRT048754	hsa-miR-93-5p	CLASH	23622248
MIRT054041	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	22310293
MIRT054580	hsa-miR-146a-5p	Immunoprecipitation, Luciferase reporter assay, QRTPCR, Western blot	23733368
MIRT574799	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT574798	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT574797	hsa-miR-8063	PAR-CLIP	20371350
MIRT498257	hsa-miR-4694-3p	PAR-CLIP	22291592
MIRT498256	hsa-miR-224-3p	PAR-CLIP	22291592
MIRT498255	hsa-miR-522-3p	PAR-CLIP	22291592
MIRT498254	hsa-miR-3926	PAR-CLIP	22291592
MIRT498253	hsa-miR-548s	PAR-CLIP	22291592
MIRT441589	hsa-miR-4769-3p	PAR-CLIP	22100165
MIRT441588	hsa-miR-6817-5p	PAR-CLIP	22100165
MIRT440727	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440727	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT731587	hsa-miR-296-5p	Luciferase reporter assay	26898797
MIRT731587	hsa-miR-296-5p	Luciferase reporter assay	26898797
MIRT731587	hsa-miR-296-5p	Luciferase reporter assay	26898797
MIRT054580	hsa-miR-146a-5p	Western blotting, RNA-seq, qRT-PCR	31425002
MIRT734817	hsa-miR-16-5p	Microarray	33530159
MIRT736017	hsa-miR-1246	Western blotting, qRT-PCR	31506750
MIRT574799	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT574798	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT574797	hsa-miR-8063	PAR-CLIP	20371350
MIRT498257	hsa-miR-4694-3p	PAR-CLIP	22291592
MIRT498256	hsa-miR-224-3p	PAR-CLIP	22291592
MIRT498255	hsa-miR-522-3p	PAR-CLIP	22291592
MIRT498254	hsa-miR-3926	PAR-CLIP	22291592
MIRT498253	hsa-miR-548s	PAR-CLIP	22291592
MIRT441589	hsa-miR-4769-3p	PAR-CLIP	22100165
MIRT441588	hsa-miR-6817-5p	PAR-CLIP	22100165
MIRT959677	hsa-miR-1200	CLIP-seq
MIRT959678	hsa-miR-1254	CLIP-seq
MIRT959679	hsa-miR-1273e	CLIP-seq
MIRT959680	hsa-miR-1304	CLIP-seq
MIRT959681	hsa-miR-145	CLIP-seq
MIRT959682	hsa-miR-147	CLIP-seq
MIRT959683	hsa-miR-150	CLIP-seq
MIRT959684	hsa-miR-15a	CLIP-seq
MIRT959685	hsa-miR-15b	CLIP-seq
MIRT959686	hsa-miR-16	CLIP-seq
MIRT959687	hsa-miR-1827	CLIP-seq
MIRT959688	hsa-miR-1910	CLIP-seq
MIRT959689	hsa-miR-195	CLIP-seq
MIRT959690	hsa-miR-2110	CLIP-seq
MIRT959691	hsa-miR-300	CLIP-seq
MIRT959692	hsa-miR-3116	CLIP-seq
MIRT959693	hsa-miR-3140-3p	CLIP-seq
MIRT959694	hsa-miR-3140-5p	CLIP-seq
MIRT959695	hsa-miR-3143	CLIP-seq
MIRT959696	hsa-miR-3148	CLIP-seq
MIRT959697	hsa-miR-3152-3p	CLIP-seq
MIRT959698	hsa-miR-3154	CLIP-seq
MIRT959699	hsa-miR-3168	CLIP-seq
MIRT959700	hsa-miR-3199	CLIP-seq
MIRT959701	hsa-miR-3545-3p	CLIP-seq
MIRT959702	hsa-miR-3611	CLIP-seq
MIRT959703	hsa-miR-3613-3p	CLIP-seq
MIRT959704	hsa-miR-3647-3p	CLIP-seq
MIRT959705	hsa-miR-3649	CLIP-seq
MIRT959706	hsa-miR-3672	CLIP-seq
MIRT959707	hsa-miR-3688-5p	CLIP-seq
MIRT959708	hsa-miR-3689a-3p	CLIP-seq
MIRT959709	hsa-miR-3689c	CLIP-seq
MIRT959710	hsa-miR-3689d	CLIP-seq
MIRT959711	hsa-miR-3714	CLIP-seq
MIRT959712	hsa-miR-378g	CLIP-seq
MIRT959713	hsa-miR-381	CLIP-seq
MIRT959714	hsa-miR-3911	CLIP-seq
MIRT959715	hsa-miR-3922-5p	CLIP-seq
MIRT959716	hsa-miR-3940-3p	CLIP-seq
MIRT959717	hsa-miR-3945	CLIP-seq
MIRT959718	hsa-miR-424	CLIP-seq
MIRT959719	hsa-miR-4251	CLIP-seq
MIRT959720	hsa-miR-4253	CLIP-seq
MIRT959721	hsa-miR-4271	CLIP-seq
MIRT959722	hsa-miR-4277	CLIP-seq
MIRT959723	hsa-miR-4326	CLIP-seq
MIRT959724	hsa-miR-4421	CLIP-seq
MIRT959725	hsa-miR-4426	CLIP-seq
MIRT959726	hsa-miR-4450	CLIP-seq
MIRT959727	hsa-miR-4459	CLIP-seq
MIRT959728	hsa-miR-4468	CLIP-seq
MIRT959729	hsa-miR-4539	CLIP-seq
MIRT959730	hsa-miR-455-3p	CLIP-seq
MIRT959731	hsa-miR-4647	CLIP-seq
MIRT959732	hsa-miR-4648	CLIP-seq
MIRT959733	hsa-miR-4652-3p	CLIP-seq
MIRT959734	hsa-miR-4654	CLIP-seq
MIRT959735	hsa-miR-4662b	CLIP-seq
MIRT959736	hsa-miR-4666-3p	CLIP-seq
MIRT959737	hsa-miR-4667-5p	CLIP-seq
MIRT959738	hsa-miR-4698	CLIP-seq
MIRT959739	hsa-miR-4700-5p	CLIP-seq
MIRT959740	hsa-miR-4722-5p	CLIP-seq
MIRT959741	hsa-miR-4725-3p	CLIP-seq
MIRT959742	hsa-miR-4728-5p	CLIP-seq
MIRT959743	hsa-miR-4740-5p	CLIP-seq
MIRT959744	hsa-miR-4760-5p	CLIP-seq
MIRT959745	hsa-miR-4765	CLIP-seq
MIRT959746	hsa-miR-4769-5p	CLIP-seq
MIRT959747	hsa-miR-4773	CLIP-seq
MIRT959748	hsa-miR-4803	CLIP-seq
MIRT959749	hsa-miR-492	CLIP-seq
MIRT959750	hsa-miR-497	CLIP-seq
MIRT959751	hsa-miR-505	CLIP-seq
MIRT959752	hsa-miR-509-3p	CLIP-seq
MIRT959753	hsa-miR-518e	CLIP-seq
MIRT959754	hsa-miR-539	CLIP-seq
MIRT959755	hsa-miR-548p	CLIP-seq
MIRT959756	hsa-miR-550a	CLIP-seq
MIRT959757	hsa-miR-580	CLIP-seq
MIRT959758	hsa-miR-637	CLIP-seq
MIRT959759	hsa-miR-644	CLIP-seq
MIRT959760	hsa-miR-661	CLIP-seq
MIRT959761	hsa-miR-875-3p	CLIP-seq
MIRT959762	hsa-miR-877	CLIP-seq
MIRT959763	hsa-miR-889	CLIP-seq
MIRT1984280	hsa-miR-1178	CLIP-seq
MIRT1984281	hsa-miR-1206	CLIP-seq
MIRT1984282	hsa-miR-1229	CLIP-seq
MIRT1984283	hsa-miR-1243	CLIP-seq
MIRT959678	hsa-miR-1254	CLIP-seq
MIRT1984284	hsa-miR-1299	CLIP-seq
MIRT1984285	hsa-miR-133a	CLIP-seq
MIRT1984286	hsa-miR-133b	CLIP-seq
MIRT1984287	hsa-miR-137	CLIP-seq
MIRT959682	hsa-miR-147	CLIP-seq
MIRT1984288	hsa-miR-197	CLIP-seq
MIRT959692	hsa-miR-3116	CLIP-seq
MIRT959696	hsa-miR-3148	CLIP-seq
MIRT959697	hsa-miR-3152-3p	CLIP-seq
MIRT1984289	hsa-miR-3194-3p	CLIP-seq
MIRT1984290	hsa-miR-330-3p	CLIP-seq
MIRT1984291	hsa-miR-345	CLIP-seq
MIRT959703	hsa-miR-3613-3p	CLIP-seq
MIRT959704	hsa-miR-3647-3p	CLIP-seq
MIRT959705	hsa-miR-3649	CLIP-seq
MIRT1984292	hsa-miR-3654	CLIP-seq
MIRT1984293	hsa-miR-3659	CLIP-seq
MIRT959707	hsa-miR-3688-5p	CLIP-seq
MIRT959710	hsa-miR-3689d	CLIP-seq
MIRT1984294	hsa-miR-377	CLIP-seq
MIRT959714	hsa-miR-3911	CLIP-seq
MIRT1984295	hsa-miR-3937	CLIP-seq
MIRT1984296	hsa-miR-3977	CLIP-seq
MIRT1984297	hsa-miR-4254	CLIP-seq
MIRT1984298	hsa-miR-4255	CLIP-seq
MIRT959724	hsa-miR-4421	CLIP-seq
MIRT1984299	hsa-miR-4422	CLIP-seq
MIRT959727	hsa-miR-4459	CLIP-seq
MIRT959728	hsa-miR-4468	CLIP-seq
MIRT1984300	hsa-miR-4522	CLIP-seq
MIRT1984301	hsa-miR-4633-3p	CLIP-seq
MIRT959733	hsa-miR-4652-3p	CLIP-seq
MIRT1984302	hsa-miR-4653-3p	CLIP-seq
MIRT1984303	hsa-miR-4658	CLIP-seq
MIRT1984304	hsa-miR-4663	CLIP-seq
MIRT959738	hsa-miR-4698	CLIP-seq
MIRT1984305	hsa-miR-4712-3p	CLIP-seq
MIRT959740	hsa-miR-4722-5p	CLIP-seq
MIRT1984306	hsa-miR-4734	CLIP-seq
MIRT1984307	hsa-miR-4753-3p	CLIP-seq
MIRT1984308	hsa-miR-4767	CLIP-seq
MIRT1984309	hsa-miR-485-3p	CLIP-seq
MIRT959749	hsa-miR-492	CLIP-seq
MIRT959751	hsa-miR-505	CLIP-seq
MIRT959754	hsa-miR-539	CLIP-seq
MIRT1984310	hsa-miR-544	CLIP-seq
MIRT1984311	hsa-miR-548ac	CLIP-seq
MIRT1984312	hsa-miR-548ae	CLIP-seq
MIRT1984313	hsa-miR-548aj	CLIP-seq
MIRT1984314	hsa-miR-548am	CLIP-seq
MIRT1984315	hsa-miR-548d-3p	CLIP-seq
MIRT959755	hsa-miR-548p	CLIP-seq
MIRT1984316	hsa-miR-548x	CLIP-seq
MIRT1984317	hsa-miR-548z	CLIP-seq
MIRT959756	hsa-miR-550a	CLIP-seq
MIRT1984318	hsa-miR-561	CLIP-seq
MIRT1984319	hsa-miR-574-5p	CLIP-seq
MIRT959757	hsa-miR-580	CLIP-seq
MIRT1984320	hsa-miR-603	CLIP-seq
MIRT959759	hsa-miR-644	CLIP-seq
MIRT959760	hsa-miR-661	CLIP-seq
MIRT1984321	hsa-miR-758	CLIP-seq
MIRT1984322	hsa-miR-759	CLIP-seq
MIRT959761	hsa-miR-875-3p	CLIP-seq
MIRT959680	hsa-miR-1304	CLIP-seq
MIRT2219403	hsa-miR-1305	CLIP-seq
MIRT1984288	hsa-miR-197	CLIP-seq
MIRT2219404	hsa-miR-219-1-3p	CLIP-seq
MIRT2219405	hsa-miR-2278	CLIP-seq
MIRT2219406	hsa-miR-3126-5p	CLIP-seq
MIRT2219407	hsa-miR-3133	CLIP-seq
MIRT959699	hsa-miR-3168	CLIP-seq
MIRT959700	hsa-miR-3199	CLIP-seq
MIRT2219408	hsa-miR-324-5p	CLIP-seq
MIRT1984290	hsa-miR-330-3p	CLIP-seq
MIRT2219409	hsa-miR-342-5p	CLIP-seq
MIRT2219410	hsa-miR-3613-5p	CLIP-seq
MIRT2219411	hsa-miR-3662	CLIP-seq
MIRT1984294	hsa-miR-377	CLIP-seq
MIRT959722	hsa-miR-4277	CLIP-seq
MIRT959724	hsa-miR-4421	CLIP-seq
MIRT1984299	hsa-miR-4422	CLIP-seq
MIRT2219412	hsa-miR-4515	CLIP-seq
MIRT2219413	hsa-miR-4520a-3p	CLIP-seq
MIRT2219414	hsa-miR-4520b-3p	CLIP-seq
MIRT2219415	hsa-miR-4529-3p	CLIP-seq
MIRT2219416	hsa-miR-4651	CLIP-seq
MIRT2219417	hsa-miR-4664-5p	CLIP-seq
MIRT959738	hsa-miR-4698	CLIP-seq
MIRT2219418	hsa-miR-4704-5p	CLIP-seq
MIRT959751	hsa-miR-505	CLIP-seq
MIRT2219419	hsa-miR-520a-5p	CLIP-seq
MIRT2219420	hsa-miR-525-5p	CLIP-seq
MIRT2219421	hsa-miR-571	CLIP-seq
MIRT2219422	hsa-miR-577	CLIP-seq
MIRT2219423	hsa-miR-579	CLIP-seq
MIRT2219424	hsa-miR-608	CLIP-seq
MIRT2219425	hsa-miR-653	CLIP-seq
MIRT2219426	hsa-miR-664	CLIP-seq
MIRT2219406	hsa-miR-3126-5p	CLIP-seq
MIRT2219409	hsa-miR-342-5p	CLIP-seq
MIRT2219416	hsa-miR-4651	CLIP-seq
MIRT2219417	hsa-miR-4664-5p	CLIP-seq
MIRT2219424	hsa-miR-608	CLIP-seq
MIRT1984281	hsa-miR-1206	CLIP-seq
MIRT959678	hsa-miR-1254	CLIP-seq
MIRT1984285	hsa-miR-133a	CLIP-seq
MIRT1984286	hsa-miR-133b	CLIP-seq
MIRT1984288	hsa-miR-197	CLIP-seq
MIRT2522713	hsa-miR-31	CLIP-seq
MIRT959692	hsa-miR-3116	CLIP-seq
MIRT2219406	hsa-miR-3126-5p	CLIP-seq
MIRT959697	hsa-miR-3152-3p	CLIP-seq
MIRT959699	hsa-miR-3168	CLIP-seq
MIRT959700	hsa-miR-3199	CLIP-seq
MIRT1984293	hsa-miR-3659	CLIP-seq
MIRT959712	hsa-miR-378g	CLIP-seq
MIRT1984296	hsa-miR-3977	CLIP-seq
MIRT1984298	hsa-miR-4255	CLIP-seq
MIRT959722	hsa-miR-4277	CLIP-seq
MIRT1984299	hsa-miR-4422	CLIP-seq
MIRT2219412	hsa-miR-4515	CLIP-seq
MIRT1984303	hsa-miR-4658	CLIP-seq
MIRT1984304	hsa-miR-4663	CLIP-seq
MIRT2522714	hsa-miR-4738-3p	CLIP-seq
MIRT1984309	hsa-miR-485-3p	CLIP-seq
MIRT2219419	hsa-miR-520a-5p	CLIP-seq
MIRT2219420	hsa-miR-525-5p	CLIP-seq
MIRT1984310	hsa-miR-544	CLIP-seq
MIRT959755	hsa-miR-548p	CLIP-seq
MIRT959756	hsa-miR-550a	CLIP-seq
MIRT1984319	hsa-miR-574-5p	CLIP-seq
MIRT959760	hsa-miR-661	CLIP-seq
MIRT1984322	hsa-miR-759	CLIP-seq
MIRT959762	hsa-miR-877	CLIP-seq
MIRT2522715	hsa-miR-9	CLIP-seq
MIRT1984281	hsa-miR-1206	CLIP-seq
MIRT2219403	hsa-miR-1305	CLIP-seq
MIRT2679886	hsa-miR-205	CLIP-seq
MIRT2522713	hsa-miR-31	CLIP-seq
MIRT2679887	hsa-miR-3144-5p	CLIP-seq
MIRT959697	hsa-miR-3152-3p	CLIP-seq
MIRT2679888	hsa-miR-3191	CLIP-seq
MIRT1984289	hsa-miR-3194-3p	CLIP-seq
MIRT2679889	hsa-miR-326	CLIP-seq
MIRT2679890	hsa-miR-330-5p	CLIP-seq
MIRT1984293	hsa-miR-3659	CLIP-seq
MIRT2679891	hsa-miR-3661	CLIP-seq
MIRT1984298	hsa-miR-4255	CLIP-seq
MIRT1984299	hsa-miR-4422	CLIP-seq
MIRT2679892	hsa-miR-4639-3p	CLIP-seq
MIRT2679893	hsa-miR-4652-5p	CLIP-seq
MIRT1984303	hsa-miR-4658	CLIP-seq
MIRT1984304	hsa-miR-4663	CLIP-seq
MIRT959737	hsa-miR-4667-5p	CLIP-seq
MIRT959739	hsa-miR-4700-5p	CLIP-seq
MIRT1984309	hsa-miR-485-3p	CLIP-seq
MIRT1984310	hsa-miR-544	CLIP-seq
MIRT1984319	hsa-miR-574-5p	CLIP-seq
MIRT2679894	hsa-miR-631	CLIP-seq
MIRT959758	hsa-miR-637	CLIP-seq
MIRT1984322	hsa-miR-759	CLIP-seq
MIRT959762	hsa-miR-877	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ZFP36	Activation	15158469

Show/Hide all(60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000512	Process	LncRNA-mediated post-transcriptional gene silencing	IEA
GO:0000932	Component	P-body	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	19561594, 21613615
GO:0003723	Function	RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579
GO:0003729	Function	MRNA binding	IEA
GO:0003729	Function	MRNA binding	TAS	10660597
GO:0003730	Function	MRNA 3'-UTR binding	IDA	26595526
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	ISS
GO:0005515	Function	Protein binding	IPI	14731398, 17632515, 17932509, 18191643, 19322201, 25416956, 25959826, 26489465, 27616329, 27974568, 31358969, 32814053
GO:0005634	Component	Nucleus	IDA	14517288
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	17632515
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	14517288, 19029303
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA	17632515
GO:0005829	Component	Cytosol	TAS
GO:0006606	Process	Protein import into nucleus	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016441	Process	Post-transcriptional gene silencing	IEA
GO:0016528	Component	Sarcoplasm	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	14517288
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032930	Process	Positive regulation of superoxide anion generation	IEA
GO:0035198	Function	MiRNA binding	IDA	26595526
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IDA	8626503, 14517288, 14731398, 16126846, 23056314, 23519412, 26489465
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	17632515
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0045727	Process	Positive regulation of translation	IDA	21613615
GO:0045727	Process	Positive regulation of translation	IEA
GO:0045772	Process	Positive regulation of autophagosome size	IEA
GO:0048255	Process	MRNA stabilization	IDA	21613615
GO:0048255	Process	MRNA stabilization	IDA	31358969
GO:0048255	Process	MRNA stabilization	IEA
GO:0048255	Process	MRNA stabilization	IMP	19029303
GO:0051260	Process	Protein homooligomerization	IDA	26595526
GO:0060965	Process	Negative regulation of miRNA-mediated gene silencing	IMP	26595526
GO:0061157	Process	MRNA destabilization	IEA
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IDA	14517288, 26489465, 29180010
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IEA
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IMP	19029303
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106222	Function	LncRNA binding	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA
GO:1990904	Component	Ribonucleoprotein complex	ISS
GO:2000036	Process	Regulation of stem cell population maintenance	IEA
GO:2000036	Process	Regulation of stem cell population maintenance	ISS

MIM	HGNC	e!Ensembl
603466	3312	ENSG00000066044

Protein

UniProt ID

Q15717

Protein name

ELAV-like protein 1 (Hu-antigen R) (HuR)

Protein function

RNA-binding protein that binds to the 3'-UTR region of mRNAs and increases their stability (PubMed:14517288, PubMed:18285462, PubMed:31358969). Involved in embryonic stem cell (ESC) differentiation: preferentially binds mRNAs that are not methyl

PDB

3HI9 , 4ED5 , 4EGL , 4FXV , 5SZW , 6G2K , 6GC5 , 6GD1 , 6GD2 , 6GD3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	22 → 92	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	108 → 176	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	246 → 316	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Detected in brain, liver, thymus and muscle. {ECO:0000269|PubMed:8626503}.

Sequence

MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHS
LGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQK
DVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPIT
VKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNA
SSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM
AIASLNGYRLGDKILQVSFKTNKSHK

Sequence length

326

Interactions

View interactions

	KEGG		Reactome
	AMPK signaling pathway IL-17 signaling pathway		HuR (ELAVL1) binds and stabilizes mRNA mRNA Splicing - Major Pathway

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (119)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	18094611, 19208339, 25010987, 26362587, 38256026
Adenocarcinoma of Lung	Associate	27058892, 36071042
Adenoma	Stimulate	19208339
Adenomatous Polyposis Coli	Associate	18094611
Alzheimer Disease	Associate	31755389
Arrest of spermatogenesis	Associate	32614269
Arthritis Rheumatoid	Inhibit	17599736
Arthritis Rheumatoid	Associate	25678110
Atherosclerosis	Stimulate	15824116
Breast Neoplasms	Associate	16914445, 18641687, 18769129, 19777567, 19875930, 20370918, 20974809, 21480233, 21503589, 22436134, 22907529, 23028944, 23605320, 24692066, 24954509 View all (11 more)
Breast Neoplasms	Stimulate	19010922
Carcinogenesis	Associate	19208339, 21161467, 21480233, 21572400, 22436134, 23259573, 23605320, 24954509, 25750985, 27075229, 27542231, 31089242, 31940247, 35721888, 36849492
Carcinoma Ductal Breast	Associate	21480233
Carcinoma Endometrioid	Associate	38256026
Carcinoma Hepatocellular	Associate	10964780, 23814050, 24719890, 28035067, 30602494, 34409736, 37021545
Carcinoma Intraductal Noninfiltrating	Stimulate	21480233
Carcinoma Non Small Cell Lung	Associate	25252849, 28855578, 29424924, 33015787, 35658874, 38049814
Carcinoma Pancreatic Ductal	Associate	19487279, 22785201, 26675757, 27053682, 27893535, 30670910, 35703534, 37685961
Carcinoma Papillary	Stimulate	26498465
Carcinoma Renal Cell	Associate	21161467, 30770799
Carcinoma Squamous Cell	Associate	21572400, 34112238, 36513874
CD59 Deficiency	Associate	35069550
Cell Transformation Neoplastic	Associate	18641687
Colonic Neoplasms	Associate	16799479
Colorectal Neoplasms	Associate	11733561, 16799479, 18094611, 20421296, 22544606, 23880304, 24865968, 28968471, 29386086, 34158864, 35130122, 35218185, 35721888, 36224588, 36380064, 36727289, 36849492 View all (2 more)
Coronary Disease	Associate	36477660
COVID 19	Associate	35938548, 36460278
Crohn Disease	Associate	32724827
Diabetic Nephropathies	Associate	35493610
Drug Related Side Effects and Adverse Reactions	Associate	28855578
Embryo Loss	Associate	16914445
Endometrial Neoplasms	Associate	20889954, 38256026
Endometriosis	Associate	20889954
Esophageal Neoplasms	Associate	23873103
Esophageal Squamous Cell Carcinoma	Associate	23873103, 31651222
Esophageal Squamous Cell Carcinoma	Inhibit	28231690
Fibromuscular Dysplasia	Associate	15824116
Fibrosis	Associate	10964780
Folate Malabsorption Hereditary	Inhibit	28445960
Gallbladder Neoplasms	Associate	31752906
Glioblastoma	Associate	22258704, 25803745, 26874904, 30991885, 35871232
Glioma	Associate	22829587, 23525947, 24815461, 25803745, 26874904, 28790173, 35285415
Hereditary Breast and Ovarian Cancer Syndrome	Associate	21480233
HTLV I Infections	Inhibit	18544151
Hyperplasia	Stimulate	15824116
Hyperplasia	Associate	36477660
Hypothyroidism Congenital Nongoitrous 2	Inhibit	20889954
Hypoxia	Stimulate	16914445, 29606096
Hypoxia	Associate	21795698, 23115237, 26325091, 26387536, 35346905
Hypoxia Brain	Associate	21795698, 22086907, 26387536
Infections	Associate	37698554
Infertility	Associate	32614269
Infertility Male	Associate	32614269
Inflammation	Associate	20451530, 26189797, 26553968, 30067974, 34533864, 35493610
Juvenile polyposis syndrome	Associate	19124115
Kidney Neoplasms	Associate	30770799
Laryngeal Neoplasms	Associate	28269752
Leukemia B Cell	Associate	26434584
Leukemia Lymphocytic Chronic B Cell	Associate	32908868, 35845961
Leukemia Myeloid Acute	Associate	35986311
Lung Neoplasms	Associate	21572400, 26494555, 28855578, 34605863, 37055376
Lupus Erythematosus Systemic	Associate	18505733, 36075396
Lymphatic Metastasis	Associate	23259573, 23873103, 25383675, 31940247
Lymphatic Metastasis	Stimulate	25252849
Macrophage Activation Syndrome	Associate	24729624
Macular Degeneration	Associate	29576851
Melanoma	Associate	26970271, 35970041
Melanoma Cutaneous Malignant	Associate	35722625
Mesothelioma	Associate	18831511
Metabolic Syndrome	Associate	33417721
Mitochondrial Diseases	Associate	26690054, 28630277
Mixed Tumor Malignant	Associate	26498465
Mouth Diseases	Associate	24534848
Mouth Neoplasms	Associate	20332213, 21795698, 27941877, 30449075
Multiple Myeloma	Associate	33530159
Multiple System Atrophy	Associate	29149290
Myeloproliferative Disorder Chronic with Eosinophilia	Stimulate	15824116
Nasopharyngeal Carcinoma	Associate	32370736, 37215987
Neoplasm Metastasis	Associate	21795698, 23259573, 25252849, 25750985, 27941336, 33894314, 35130122, 36071042
Neoplasms	Associate	11733561, 16799479, 17548472, 18094611, 18829526, 18831511, 19114552, 19208339, 19487279, 19875930, 20370918, 20889542, 21152064, 21161467, 21209379 View all (46 more)
Neoplasms	Inhibit	27058892
Neoplasms	Stimulate	27542231
Oropharyngeal Neoplasms	Associate	30289952
Osteosarcoma	Associate	30182452, 32266933, 36053455
Ovarian Diseases	Associate	27075229, 33894314
Ovarian Neoplasms	Associate	23394580, 26943573, 27075229, 28365935, 33894314, 35624501, 37684273, 39809219
Pancreatic Neoplasms	Associate	19487279, 21152064, 22785201, 23807417, 26362587, 26387536, 26675757, 27053682, 27893535, 30670910
Papillomavirus Infections	Associate	30289952
Parkinson Disease	Associate	29149290, 36593912
Personality Disorders	Associate	33015787
Plaque Atherosclerotic	Associate	24729624
Polyposis Syndrome Hereditary Mixed 1	Associate	18094611
Prostatic Neoplasms	Associate	21971048, 27102850, 27140699, 34335955, 35562348, 37647111, 39265220
Prostatic Neoplasms Castration Resistant	Stimulate	27140699
Pulmonary Disease Chronic Obstructive	Associate	29866111, 35011584
Purpura Thrombotic Thrombocytopenic	Associate	29424924
Rectal Neoplasms	Associate	32331433
Respiratory Distress Syndrome	Associate	27215284
Sarcoidosis	Associate	27575817
Sarcoidosis Pulmonary	Associate	27575817
Sarcoma Ewing	Associate	34662337
Sclerosis	Associate	15824116
Smoke Inhalation Injury	Associate	32614269
Squamous Cell Carcinoma of Head and Neck	Associate	20332213, 21795698, 27941336, 28435450
Stomach Neoplasms	Associate	16474375, 31940247, 33824303, 33879018
Thrombosis	Associate	35938548
Thyroid Cancer Papillary	Associate	35352515
Thyroid Diseases	Associate	26498465
Thyroid Neoplasms	Associate	27542231, 31089242, 35030041
Triple Negative Breast Neoplasms	Stimulate	27588488
Triple Negative Breast Neoplasms	Associate	35711895
Tuberculosis Multidrug Resistant	Associate	28968471
Urinary Bladder Neoplasms	Associate	36293387
Urologic Neoplasms	Associate	23259573
Uterine Cervical Neoplasms	Associate	20007147, 22841487, 26819413, 28080204, 32515533, 32757457, 35595754
Uterine Diseases	Inhibit	20889954
Vision Disorders	Associate	25678110, 26325091, 30214075
von Hippel Lindau Disease	Associate	22086907
Wounds and Injuries	Associate	35493610

ELAVL1 (ELAV like RNA binding protein 1)