Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	199
Gene name Gene Name - the full gene name approved by the HGNC.	Allograft inflammatory factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AIF1
Synonyms (NCBI Gene) Gene synonyms aliases	AIF-1, IBA1, IRT-1, IRT1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated wit

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments
MIRT774211	hsa-miR-188-5p	CLIP-seq
MIRT774212	hsa-miR-204	CLIP-seq
MIRT774213	hsa-miR-211	CLIP-seq
MIRT774214	hsa-miR-4446-5p	CLIP-seq
MIRT774215	hsa-miR-4755-5p	CLIP-seq
MIRT774216	hsa-miR-623	CLIP-seq
MIRT774217	hsa-miR-1275	CLIP-seq
MIRT774218	hsa-miR-1294	CLIP-seq
MIRT774219	hsa-miR-3150b-3p	CLIP-seq
MIRT774220	hsa-miR-3154	CLIP-seq
MIRT774221	hsa-miR-3179	CLIP-seq
MIRT774222	hsa-miR-4270	CLIP-seq
MIRT774223	hsa-miR-4316	CLIP-seq
MIRT774224	hsa-miR-4441	CLIP-seq
MIRT774225	hsa-miR-4450	CLIP-seq
MIRT774226	hsa-miR-4525	CLIP-seq
MIRT774227	hsa-miR-4665-5p	CLIP-seq
MIRT774228	hsa-miR-4723-5p	CLIP-seq
MIRT774229	hsa-miR-4764-5p	CLIP-seq
MIRT774230	hsa-miR-4772-5p	CLIP-seq
MIRT774231	hsa-miR-4784	CLIP-seq
MIRT774232	hsa-miR-483-3p	CLIP-seq
MIRT774233	hsa-miR-570	CLIP-seq
MIRT774234	hsa-miR-625	CLIP-seq
MIRT774235	hsa-miR-765	CLIP-seq
MIRT1928483	hsa-miR-149	CLIP-seq
MIRT1928484	hsa-miR-3064-5p	CLIP-seq
MIRT1928485	hsa-miR-4522	CLIP-seq
MIRT1928486	hsa-miR-4794	CLIP-seq
MIRT1928487	hsa-miR-653	CLIP-seq
MIRT2169253	hsa-miR-1273f	CLIP-seq
MIRT2169254	hsa-miR-143	CLIP-seq
MIRT2169255	hsa-miR-4708-5p	CLIP-seq
MIRT2169256	hsa-miR-4747-5p	CLIP-seq
MIRT2169257	hsa-miR-4770	CLIP-seq
MIRT2169258	hsa-miR-563	CLIP-seq

Show/Hide all(73)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0001726	Component	Ruffle	ISS
GO:0001774	Process	Microglial cell activation	NAS	17011575
GO:0001891	Component	Phagocytic cup	IEA
GO:0001891	Component	Phagocytic cup	ISS
GO:0003779	Function	Actin binding	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS	17011575
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IDA	22116621
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IDA	12887599, 28601280
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA	22116621
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IBA
GO:0005884	Component	Actin filament	IDA	18699778
GO:0005884	Component	Actin filament	IEA
GO:0005884	Component	Actin filament	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0006911	Process	Phagocytosis, engulfment	IEA
GO:0006911	Process	Phagocytosis, engulfment	ISS
GO:0006954	Process	Inflammatory response	ISS
GO:0006954	Process	Inflammatory response	NAS	7769138
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	19745784
GO:0010468	Process	Regulation of gene expression	HDA	24796669
GO:0016020	Component	Membrane	IEA
GO:0016601	Process	Rac protein signal transduction	IEA
GO:0016601	Process	Rac protein signal transduction	ISS
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030041	Process	Actin filament polymerization	IDA	16049345
GO:0030046	Process	Parallel actin filament bundle assembly	IEA
GO:0030046	Process	Parallel actin filament bundle assembly	ISS
GO:0030335	Process	Positive regulation of cell migration	IDA	19745784
GO:0032587	Component	Ruffle membrane	IBA
GO:0032587	Component	Ruffle membrane	IDA	18699778
GO:0032587	Component	Ruffle membrane	IEA
GO:0032722	Process	Positive regulation of chemokine production	IDA	24796669
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	24796669
GO:0034599	Process	Cellular response to oxidative stress	IDA	12887599
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	16049345
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	9614071
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	15117732, 22116621
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	9614071, 22116621
GO:0050921	Process	Positive regulation of chemotaxis	IDA	24796669
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IDA	16049345, 18699778
GO:0051015	Function	Actin filament binding	IEA
GO:0051017	Process	Actin filament bundle assembly	IBA
GO:0051017	Process	Actin filament bundle assembly	IDA	18699778
GO:0051017	Process	Actin filament bundle assembly	IEA
GO:0051764	Process	Actin crosslink formation	IEA
GO:0051764	Process	Actin crosslink formation	ISS
GO:0071346	Process	Cellular response to type II interferon	IEP	9614071
GO:0071346	Process	Cellular response to type II interferon	ISS
GO:0071672	Process	Negative regulation of smooth muscle cell chemotaxis	IDA	22116621
GO:0071673	Process	Positive regulation of smooth muscle cell chemotaxis	IDA	22116621
GO:0071677	Process	Positive regulation of mononuclear cell migration	IDA	24796669
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	15117732
GO:0090271	Process	Positive regulation of fibroblast growth factor production	IDA	19745784
GO:0097178	Process	Ruffle assembly	IBA
GO:0097178	Process	Ruffle assembly	IEA
GO:0097178	Process	Ruffle assembly	ISS
GO:0097178	Process	Ruffle assembly	NAS	17011575
GO:0097386	Component	Glial cell projection	IEA
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IDA	11557666, 15117732, 19745784
GO:2000406	Process	Positive regulation of T cell migration	IDA	16049345

MIM	HGNC	e!Ensembl
601833	352	ENSG00000204472

Protein

UniProt ID

P55008

Protein name

Allograft inflammatory factor 1 (AIF-1) (Ionized calcium-binding adapter molecule 1) (Protein G1)

Protein function

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Prom

PDB

2D58 , 2G2B

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Detected in T-lymphocytes and peripheral blood mononuclear cells. {ECO:0000269|PubMed:16049345}.

Sequence

MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLN
GNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKM
ILMYEEKAREKEKPTGPPAKKAISELP

Sequence length

147

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (78)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	28365005, 35247551
Alcoholism	Associate	18190912
Alzheimer Disease	Associate	23943781, 25362031, 27256292, 28365005, 31454549, 31703599, 33597025, 35247551
Amyotrophic Lateral Sclerosis	Associate	22720079
Amyotrophic lateral sclerosis 1	Associate	30215603
Arthritis Rheumatoid	Stimulate	24018427
Arthritis Rheumatoid	Associate	24018427, 32708725
Atherosclerosis	Associate	15784173, 34925641
Autism Spectrum Disorder	Associate	27957319
Behcet Syndrome	Associate	30252881
Bipolar Disorder	Associate	32062729, 38303428
Brain Contusion	Associate	27442380
Breast Neoplasms	Associate	23221708
Carcinogenesis	Associate	36520870
Carcinoma Hepatocellular	Associate	37914817
Carcinoma Non Small Cell Lung	Associate	36520870
Carotid Artery Injuries	Associate	16049345
Cerebral Infarction	Associate	11078214
Chronic Urticaria	Associate	36531995
Cognition Disorders	Associate	32066474
Cognitive Dysfunction	Stimulate	32066474
Coronary Artery Disease	Associate	16049345
COVID 19	Associate	35818336
Cystic Fibrosis	Associate	33111836, 33407736
Dementia	Associate	27256292, 37087107
Dermatomyositis	Associate	39447013
Diabetic Nephropathies	Inhibit	37916327
Diabetic Neuropathies	Inhibit	37527931
Diabetic Retinopathy	Associate	32993645
Diabetic Retinopathy	Stimulate	36430950
Encephalitis	Associate	17533487
Encephalitis	Stimulate	25438677
Epilepsy Temporal Lobe	Associate	39377933
Esophageal Squamous Cell Carcinoma	Associate	12901795
Glioblastoma	Associate	34713474
Glioma	Associate	27287871, 37014322
Graft vs Host Disease	Stimulate	17533487
Graft vs Host Disease	Associate	20190732
Hereditary Diffuse Leukoencephalopathy with Spheroids	Inhibit	32430064
Hyperplasia	Associate	35586138
Inflammation	Associate	17533487, 29897458, 30193587, 32708725
Insomnia Fatal Familial	Associate	23816234
Leukoencephalopathies	Associate	30682074
Lichen Planus	Stimulate	17533487
Lung Neoplasms	Stimulate	37679517
Lymphoma Large B Cell Diffuse	Associate	21148756
Lymphoma Non Hodgkin	Associate	21148756
Melanoma	Associate	37014322
Mucocutaneous Lymph Node Syndrome	Stimulate	28505365
Mucocutaneous Lymph Node Syndrome	Associate	28707750
Multiple Sclerosis	Associate	24886140
Muscular Dystrophy Duchenne	Associate	34922439
Mycosis Fungoides	Stimulate	17533487
Nasal Polyps	Associate	36466903
Neoplasm Metastasis	Stimulate	21224047, 36520870
Neoplasm Metastasis	Associate	26272668
Neoplasms	Associate	20585448, 26272668, 27287871, 31221176, 36417130, 36520870
Neoplasms	Stimulate	37014322
Nervous System Diseases	Associate	37527931
Neurocognitive Disorders	Associate	25636782
Neuroinflammatory Diseases	Associate	26637429, 32210464
Obesity	Associate	21720444
Overbite	Inhibit	30682074
Parkinson Disease	Stimulate	34983390
Psoriasis	Stimulate	17533487
Pulmonary Arterial Hypertension	Stimulate	20808962
Renal Artery Obstruction	Associate	28505365
Reticular dysgenesis	Associate	27039021
Retinitis	Associate	36430950
Schizophrenia	Inhibit	27957319
Schizophrenia	Associate	32062729
Scleroderma Systemic	Associate	20190732
Skin Abnormalities	Stimulate	17533487
Skin Diseases	Associate	17533487
Spondylitis Ankylosing	Associate	40593526
Uremia	Associate	39799338
Uterine Cervical Neoplasms	Associate	23255846
Vascular Calcification	Associate	39799338

AIF1 (allograft inflammatory factor 1)