AIF1 (allograft inflammatory factor 1)

Gene

• Entrez ID: 199
• Gene name: Allograft inflammatory factor 1
• Gene symbol: AIF1
• Synonyms (NCBI Gene): AIF-1, IBA1, IRT-1, IRT1
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated wit

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT774211	hsa-miR-188-5p	CLIP-seq
MIRT774212	hsa-miR-204	CLIP-seq
MIRT774213	hsa-miR-211	CLIP-seq
MIRT774214	hsa-miR-4446-5p	CLIP-seq
MIRT774215	hsa-miR-4755-5p	CLIP-seq
MIRT774216	hsa-miR-623	CLIP-seq
MIRT774217	hsa-miR-1275	CLIP-seq
MIRT774218	hsa-miR-1294	CLIP-seq
MIRT774219	hsa-miR-3150b-3p	CLIP-seq
MIRT774220	hsa-miR-3154	CLIP-seq
MIRT774221	hsa-miR-3179	CLIP-seq
MIRT774222	hsa-miR-4270	CLIP-seq
MIRT774223	hsa-miR-4316	CLIP-seq
MIRT774224	hsa-miR-4441	CLIP-seq
MIRT774225	hsa-miR-4450	CLIP-seq
MIRT774226	hsa-miR-4525	CLIP-seq
MIRT774227	hsa-miR-4665-5p	CLIP-seq
MIRT774228	hsa-miR-4723-5p	CLIP-seq
MIRT774229	hsa-miR-4764-5p	CLIP-seq
MIRT774230	hsa-miR-4772-5p	CLIP-seq
MIRT774231	hsa-miR-4784	CLIP-seq
MIRT774232	hsa-miR-483-3p	CLIP-seq
MIRT774233	hsa-miR-570	CLIP-seq
MIRT774234	hsa-miR-625	CLIP-seq
MIRT774235	hsa-miR-765	CLIP-seq
MIRT1928483	hsa-miR-149	CLIP-seq
MIRT1928484	hsa-miR-3064-5p	CLIP-seq
MIRT1928485	hsa-miR-4522	CLIP-seq
MIRT1928486	hsa-miR-4794	CLIP-seq
MIRT1928487	hsa-miR-653	CLIP-seq
MIRT2169253	hsa-miR-1273f	CLIP-seq
MIRT2169254	hsa-miR-143	CLIP-seq
MIRT2169255	hsa-miR-4708-5p	CLIP-seq
MIRT2169256	hsa-miR-4747-5p	CLIP-seq
MIRT2169257	hsa-miR-4770	CLIP-seq
MIRT2169258	hsa-miR-563	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0001726	Component	Ruffle	ISS
GO:0001774	Process	Microglial cell activation	NAS	17011575
GO:0001891	Component	Phagocytic cup	IEA
GO:0001891	Component	Phagocytic cup	ISS
GO:0003779	Function	Actin binding	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS	17011575
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IDA	22116621
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IDA	12887599, 28601280
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA	22116621
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IBA
GO:0005884	Component	Actin filament	IDA	18699778
GO:0005884	Component	Actin filament	IEA
GO:0005884	Component	Actin filament	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0006911	Process	Phagocytosis, engulfment	IEA
GO:0006911	Process	Phagocytosis, engulfment	ISS
GO:0006954	Process	Inflammatory response	ISS
GO:0006954	Process	Inflammatory response	NAS	7769138
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	19745784
GO:0010468	Process	Regulation of gene expression	HDA	24796669
GO:0016020	Component	Membrane	IEA
GO:0016601	Process	Rac protein signal transduction	IEA
GO:0016601	Process	Rac protein signal transduction	ISS
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030041	Process	Actin filament polymerization	IDA	16049345
GO:0030046	Process	Parallel actin filament bundle assembly	IEA
GO:0030046	Process	Parallel actin filament bundle assembly	ISS
GO:0030335	Process	Positive regulation of cell migration	IDA	19745784
GO:0032587	Component	Ruffle membrane	IBA
GO:0032587	Component	Ruffle membrane	IDA	18699778
GO:0032587	Component	Ruffle membrane	IEA
GO:0032722	Process	Positive regulation of chemokine production	IDA	24796669
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	24796669
GO:0034599	Process	Cellular response to oxidative stress	IDA	12887599
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	16049345
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	9614071
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	15117732, 22116621
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	9614071, 22116621
GO:0050921	Process	Positive regulation of chemotaxis	IDA	24796669
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IDA	16049345, 18699778
GO:0051015	Function	Actin filament binding	IEA
GO:0051017	Process	Actin filament bundle assembly	IBA
GO:0051017	Process	Actin filament bundle assembly	IDA	18699778
GO:0051017	Process	Actin filament bundle assembly	IEA
GO:0051764	Process	Actin crosslink formation	IEA
GO:0051764	Process	Actin crosslink formation	ISS
GO:0071346	Process	Cellular response to type II interferon	IEP	9614071
GO:0071346	Process	Cellular response to type II interferon	ISS
GO:0071672	Process	Negative regulation of smooth muscle cell chemotaxis	IDA	22116621
GO:0071673	Process	Positive regulation of smooth muscle cell chemotaxis	IDA	22116621
GO:0071677	Process	Positive regulation of mononuclear cell migration	IDA	24796669
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	15117732
GO:0090271	Process	Positive regulation of fibroblast growth factor production	IDA	19745784
GO:0097178	Process	Ruffle assembly	IBA
GO:0097178	Process	Ruffle assembly	IEA
GO:0097178	Process	Ruffle assembly	ISS
GO:0097178	Process	Ruffle assembly	NAS	17011575
GO:0097386	Component	Glial cell projection	IEA
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IDA	11557666, 15117732, 19745784
GO:2000406	Process	Positive regulation of T cell migration	IDA	16049345

Other IDs

• MIM: 601833
• HGNC: 352
• e!Ensembl: ENSG00000204472

Protein

• UniProt ID: P55008
• Protein name: Allograft inflammatory factor 1 (AIF-1) (Ionized calcium-binding adapter molecule 1) (Protein G1)
• Protein function: Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Prom
• PDB: 2D58, 2G2B
• Tissue specificity: TISSUE SPECIFICITY: Detected in T-lymphocytes and peripheral blood mononuclear cells. {ECO:0000269|PubMed:16049345}.
• Sequence:

  MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLN
  GNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKM
  ILMYEEKAREKEKPTGPPAKKAISELP

• Sequence length: 147