Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1984
Gene name Gene Name - the full gene name approved by the HGNC.
Eukaryotic translation initiation factor 5A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EIF5A
Synonyms (NCBI Gene) Gene synonyms aliases
EIF-5A, EIF5A1, FABAS, eIF-4D, eIF5AI
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p13.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050318 hsa-miR-25-3p CLASH 23622248
MIRT048616 hsa-miR-99a-5p CLASH 23622248
MIRT048525 hsa-miR-100-5p CLASH 23622248
MIRT047232 hsa-miR-181b-5p CLASH 23622248
MIRT042623 hsa-miR-423-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22681889
GO:0003723 Function RNA binding IDA 15303967
GO:0003723 Function RNA binding IEA
GO:0003746 Function Translation elongation factor activity IBA
GO:0003746 Function Translation elongation factor activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600187 3300 ENSG00000132507
Protein
UniProt ID P63241
Protein name Eukaryotic translation initiation factor 5A-1 (eIF-5A-1) (eIF-5A1) (Eukaryotic initiation factor 5A isoform 1) (eIF-5A) (Rev-binding factor) (eIF-4D)
Protein function Translation factor that promotes translation elongation and termination, particularly upon ribosome stalling at specific amino acid sequence contexts (PubMed:33547280). Binds between the exit (E) and peptidyl (P) site of the ribosome and promote
PDB 3CPF , 5DLQ , 8A0E , 8Y0W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01287 eIF-5a 83 150 Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level). {ECO:0000269|PubMed:16519677}.
Sequence
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLG
KEIEQKYDCGEEILITVLSAMTEEAAVAIK
AMAK
Sequence length 154
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Hypusine synthesis from eIF5A-lysine
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Uterine Fibroids Uterine fibroids N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Inhibit 30206208
Acidosis Associate 33188200
Breast Neoplasms Associate 31558321, 31839604
Carcinoma Non Small Cell Lung Associate 34921595
Carcinoma Ovarian Epithelial Associate 35718769
Carcinoma Pancreatic Ductal Associate 26483550, 28381547
Cell Transformation Neoplastic Associate 32802869
Central Nervous System Diseases Associate 37047039
Colorectal Neoplasms Associate 32802869
Developmental Disabilities Associate 36973244