Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1983
Gene name Gene Name - the full gene name approved by the HGNC.
Eukaryotic translation initiation factor 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EIF5
Synonyms (NCBI Gene) Gene synonyms aliases
EIF-5, EIF-5A
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.32
Summary Summary of gene provided in NCBI Entrez Gene.
Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal init
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030925 hsa-miR-21-5p Microarray 18591254
MIRT031742 hsa-miR-16-5p Proteomics 18668040
MIRT045909 hsa-miR-125b-5p CLASH 23622248
MIRT045098 hsa-miR-186-5p CLASH 23622248
MIRT405774 hsa-miR-8066 PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001731 Process Formation of translation preinitiation complex IBA 21873635
GO:0001732 Process Formation of cytoplasmic translation initiation complex IBA 21873635
GO:0003723 Function RNA binding HDA 22681889
GO:0003743 Function Translation initiation factor activity IBA 21873635
GO:0005092 Function GDP-dissociation inhibitor activity IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601710 3299 ENSG00000100664
Protein
UniProt ID P55010
Protein name Eukaryotic translation initiation factor 5 (eIF-5)
Protein function Component of the 43S pre-initiation complex (43S PIC), which binds to the mRNA cap-proximal region, scans mRNA 5'-untranslated region, and locates the initiation codon (PubMed:11166181, PubMed:22813744, PubMed:24319994). In this complex, acts as
PDB 2E9H , 2G2K , 2IU1 , 8OZ0 , 8PJ2 , 8PJ3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01873 eIF-5_eIF-2B 6 128 Domain found in IF2B/IF5 Family
PF02020 W2 310 392 eIF4-gamma/eIF5/eIF2-epsilon Family
Sequence
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCE
LGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGN
SCKACGYR
GMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPP
PPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERV
NILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHF
LRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASK
KYVSKELAKEIRVKAEPFIKWLKEAEEESSGG
EEEDEDENIEVVYSKAASVPKVETVKSD
NKDDDIDIDAI
Sequence length 431
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
21743468
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 26512942
Ataxia Associate 12707859
Breast Neoplasms Male Associate 27986751
Central Nervous System Diseases Associate 12707859
Endometrial Neoplasms Associate 31817792
Glutathione Peroxidase Deficiency Hemolytic Anemia possibly due to Inhibit 33194959
Leukoencephalopathies Associate 12707859
Nervous System Diseases Associate 12707859
Pre Eclampsia Associate 36421809