Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	197320
Gene name	Zinc finger protein 778
Gene symbol	ZNF778
Synonyms (NCBI Gene)	-
Chromosome	16
Chromosome location	16q24.3
Summary	The protein encoded by this gene is a member of the krueppel C2H2-type zinc-finger protein family, and it contains one KRAB domain and eighteen C2H2-type zinc fingers. This gene is a candidate gene for autism and variable cognitive impairment in the 16q24

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050018	hsa-miR-27a-3p	CLASH	23622248
MIRT1539372	hsa-miR-1178	CLIP-seq
MIRT1539373	hsa-miR-1278	CLIP-seq
MIRT1539374	hsa-miR-139-5p	CLIP-seq
MIRT1539375	hsa-miR-3120-3p	CLIP-seq
MIRT1539376	hsa-miR-3167	CLIP-seq
MIRT1539377	hsa-miR-3973	CLIP-seq
MIRT1539378	hsa-miR-4289	CLIP-seq
MIRT1539379	hsa-miR-4457	CLIP-seq
MIRT1539380	hsa-miR-4463	CLIP-seq
MIRT1539381	hsa-miR-4468	CLIP-seq
MIRT1539382	hsa-miR-4494	CLIP-seq
MIRT1539383	hsa-miR-4773	CLIP-seq
MIRT1539384	hsa-miR-513b	CLIP-seq
MIRT1539385	hsa-miR-520g	CLIP-seq
MIRT1539386	hsa-miR-520h	CLIP-seq
MIRT1539387	hsa-miR-548k	CLIP-seq
MIRT1539388	hsa-miR-765	CLIP-seq
MIRT1539389	hsa-miR-767-3p	CLIP-seq
MIRT1539390	hsa-miR-876-5p	CLIP-seq
MIRT1539391	hsa-miR-1183	CLIP-seq
MIRT1539374	hsa-miR-139-5p	CLIP-seq
MIRT1539392	hsa-miR-181a	CLIP-seq
MIRT1539393	hsa-miR-181b	CLIP-seq
MIRT1539394	hsa-miR-181c	CLIP-seq
MIRT1539395	hsa-miR-181d	CLIP-seq
MIRT1539396	hsa-miR-3137	CLIP-seq
MIRT1539397	hsa-miR-3138	CLIP-seq
MIRT1539398	hsa-miR-3145-5p	CLIP-seq
MIRT1539376	hsa-miR-3167	CLIP-seq
MIRT1539399	hsa-miR-4262	CLIP-seq
MIRT1539378	hsa-miR-4289	CLIP-seq
MIRT1539379	hsa-miR-4457	CLIP-seq
MIRT1539380	hsa-miR-4463	CLIP-seq
MIRT1539382	hsa-miR-4494	CLIP-seq
MIRT1539400	hsa-miR-4659a-3p	CLIP-seq
MIRT1539401	hsa-miR-4659b-3p	CLIP-seq
MIRT1539402	hsa-miR-4667-3p	CLIP-seq
MIRT1539383	hsa-miR-4773	CLIP-seq
MIRT1539403	hsa-miR-4797-5p	CLIP-seq
MIRT1539404	hsa-miR-483-3p	CLIP-seq
MIRT1539405	hsa-miR-587	CLIP-seq
MIRT1539406	hsa-miR-624	CLIP-seq
MIRT1539388	hsa-miR-765	CLIP-seq
MIRT1539390	hsa-miR-876-5p	CLIP-seq
MIRT2162947	hsa-miR-3140-5p	CLIP-seq
MIRT2162948	hsa-miR-324-5p	CLIP-seq
MIRT1539398	hsa-miR-3145-5p	CLIP-seq
MIRT1539404	hsa-miR-483-3p	CLIP-seq
MIRT2382056	hsa-miR-3617	CLIP-seq
MIRT2382057	hsa-miR-3620	CLIP-seq
MIRT1539400	hsa-miR-4659a-3p	CLIP-seq
MIRT1539401	hsa-miR-4659b-3p	CLIP-seq
MIRT1539402	hsa-miR-4667-3p	CLIP-seq
MIRT2382058	hsa-miR-641	CLIP-seq
MIRT2397738	hsa-miR-361-3p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q96MU6

Protein name

Zinc finger protein 778

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	41 → 82	KRAB box	Family
PF00096	zf-C2H2	365 → 387	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	393 → 415	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	421 → 443	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	449 → 471	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	477 → 499	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	505 → 527	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	533 → 555	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	561 → 583	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	589 → 611	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	617 → 639	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	645 → 667	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	673 → 694	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	701 → 723	Zinc finger, C2H2 type	Domain

Sequence

MAAPDLAHGGHVSRDSVCLHEEQTQAAGMVAGWLINCYQDAVTFDDVAVDFTQEEWTLLD
PSQRDLYRDVMLENYENLASVEWRLKTKGPALRQDRSWFRASNETQTARSHNGGQLCDRT
QCGEAFSEHSGLSTHVRTQNTGDSCVSNHYERDFFIPCQKTLFKIGEQFSVLGQCGKAFS
STPNVVSQQACTRDRSLDYSSCGEVFLNQSYLQARAGSHNGEETWKWKPCGKALTHSMGC
ATPVEMHAVRNPHVCRECGKAFRYTAYLTGRVQVHPGEKPCELEECGKASPVSSSLTQHV
RIHAAEKPCECKECGKAFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHT
REKPFACVVCGKYFRNSSCLNNHVRIHTGIKPYTCSYCGKAFTVRCGLTRHVRTHTGEKP
YTCKDCGKAFCTSSGLTEHVRTHTGEKPYECKDCGKSFTVSSSLTEHARIHTGEKPYECK
QCGKAFTGRSGLTKHMRTHTGEKPYECKDCGKAYNRVYLLNEHVKTHTEEKPFICTVCRK
SFRNSSCLNKHIQIHTGIKPYECKDCGKTFTVSSSLTEHIRTHTGEKPYECKVCGKAFTT
SSHLIVHIRTHTGEKPYICKECGKAFASSSHLIEHRRTHTGEKPYICNECGKAFRASSHL
HKHGRIHTGQKPYKCKECGKAYNRFYLLKEHLKTYTEEQVFVCKDCGKSFKNSSCLNHHT
QIHTDEKPF

Sequence length

729

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Microcephaly	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Seizure	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Autism Spectrum Disorder	Associate	19920853	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Associate	19920853	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Associate	19920853	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	19920853	★★★★★ ★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Associate	19920853	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Associate	28422132	★★★★★ ★☆☆☆☆ Found in Text Mining only
KBG syndrome	Associate	28422132	★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndrome	Associate	19920853	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF778 (zinc finger protein 778)