Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	196883
Gene name Gene Name - the full gene name approved by the HGNC.	Adenylate cyclase 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADCY4
Synonyms (NCBI Gene) Gene synonyms aliases	AC4
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). Mouse studies show that adenylate cyclase 4, along with ade

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003091	Process	Renal water homeostasis	TAS
GO:0004016	Function	Adenylate cyclase activity	IBA	21873635
GO:0004016	Function	Adenylate cyclase activity	ISS
GO:0005080	Function	Protein kinase C binding	IDA	17081159
GO:0005515	Function	Protein binding	IPI	17081159, 25416956, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	11549699
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006171	Process	CAMP biosynthetic process	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	ISS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	TAS
GO:0007190	Process	Activation of adenylate cyclase activity	TAS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS
GO:0016020	Component	Membrane	ISS
GO:0030425	Component	Dendrite	IEA
GO:0034199	Process	Activation of protein kinase A activity	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0071377	Process	Cellular response to glucagon stimulus	TAS

MIM	HGNC	e!Ensembl
600292	235	ENSG00000129467

Protein

UniProt ID

Q8NFM4

Protein name

Adenylate cyclase type 4 (EC 4.6.1.1) (ATP pyrophosphate-lyase 4) (Adenylate cyclase type IV) (Adenylyl cyclase 4)

Protein function

Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16214	AC_N	4 → 249	Adenylyl cyclase N-terminal extracellular and transmembrane region	Family
PF00211	Guanylate_cyc	264 → 436	Adenylate and Guanylate cyclase catalytic domain	Domain
PF06327	DUF1053	479 → 584	Domain of Unknown Function (DUF1053)	Family
PF00211	Guanylate_cyc	864 → 1064	Adenylate and Guanylate cyclase catalytic domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in the zona glomerulosa and the zona fasciculata in the adrenal gland (at protein level). {ECO:0000269|PubMed:11549699}.

Sequence

MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTR
YLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG

Sequence length

1077

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Metabolic pathways Endocrine resistance Rap1 signaling pathway Calcium signaling pathway cGMP-PKG signaling pathway cAMP signaling pathway Chemokine signaling pathway Phospholipase D signaling pathway Hormone signaling Oocyte meiosis Longevity regulating pathway Longevity regulating pathway - multiple species Adrenergic signaling in cardiomyocytes Vascular smooth muscle contraction Apelin signaling pathway Gap junction Platelet activation Circadian entrainment Thermogenesis Retrograde endocannabinoid signaling Glutamatergic synapse Cholinergic synapse GABAergic synapse Taste transduction Inflammatory mediator regulation of TRP channels Insulin secretion GnRH signaling pathway Ovarian steroidogenesis Progesterone-mediated oocyte maturation Estrogen signaling pathway Melanogenesis Thyroid hormone synthesis Oxytocin signaling pathway Regulation of lipolysis in adipocytes Aldosterone synthesis and secretion Relaxin signaling pathway Cortisol synthesis and secretion Parathyroid hormone synthesis, secretion and action Cushing syndrome Growth hormone synthesis, secretion and action Salivary secretion Gastric acid secretion Pancreatic secretion Bile secretion Morphine addiction Human cytomegalovirus infection Human T-cell leukemia virus 1 infection Pathways in cancer Chemical carcinogenesis - receptor activation Dilated cardiomyopathy		Glucagon signaling in metabolic regulation PKA activation PKA activation in glucagon signalling Adenylate cyclase activating pathway Adenylate cyclase inhibitory pathway G alpha (s) signalling events G alpha (z) signalling events Vasopressin regulates renal water homeostasis via Aquaporins Hedgehog 'off' state ADORA2B mediated anti-inflammatory cytokines production FCGR3A-mediated IL10 synthesis

ADCY4 (adenylate cyclase 4)