CCER1 (coiled-coil glutamate rich protein 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 196477
Gene name Coiled-coil glutamate rich protein 1
Gene symbol CCER1
Synonyms (NCBI Gene)
C12orf12
Chromosome 12
Chromosome location 12q21.33
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT018074 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus ISS
GO:0007283 Process Spermatogenesis IEA
GO:0007283 Process Spermatogenesis ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
620881 28373 ENSG00000197651
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TC90
Protein name Coiled-coil domain-containing glutamate-rich protein 1
Protein function Regulator of histone epigenetic modifications and chromatin compaction into the sperm head, required for histone-to-protamine (HTP) transition. HTP is a key event in which somatic histones are first replaced by testis-specific histone variants,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15482 CCER1 4 → 219 Coiled-coil domain-containing glutamate-rich protein family 1 Coiled-coil
Sequence 
MTQTLDTREDPLNLGGGGGGGCGCGWAHSASLSSWSSCHRRRPGAPAYNRPHRYSPKTEY
GPPRKQPKQQHGPGFWFQPPVCSNWGCWGGPWRPPPPGFWKFPCPVQVFRVYGLHPLCFC
CCSCWSGSWNPGWVKPPGRKKRWGRRGRGLRHHPRHSYPRSPPADVSTLPRPVKLYEWRE
PGMRAPPNTTQFIMNQIYEDMRQQEKVERQQEALRAQKATVSGEASPARSSGNDAPPGGS
KETWGLQETLYGFVQNPSLAFSPNPEENQSLAPLLVEEEEEKKNDDEEEYDQEVCDAKEA
SEEEEEVEDEEEEVEDEEEEEVEEAEYVEEGEEELEEEELEEEEEVLEENEQRGEEFHLP
LEMPLSIFVEAEEKRENFISCTFLNPEQIIPKVPQESLFMAQDFNC
Sequence length 406
Interactions View interactions