Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	196410
Gene name Gene Name - the full gene name approved by the HGNC.	Thiol methyltransferase 1B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TMT1B
Synonyms (NCBI Gene) Gene synonyms aliases	ALDI, METTL7B
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.2

Show/Hide all(55)

miRTarBase ID	miRNA	Experiments
MIRT1144932	hsa-miR-1208	CLIP-seq
MIRT1144933	hsa-miR-1238	CLIP-seq
MIRT1144934	hsa-miR-3185	CLIP-seq
MIRT1144935	hsa-miR-361-3p	CLIP-seq
MIRT1144936	hsa-miR-3664-3p	CLIP-seq
MIRT1144937	hsa-miR-4255	CLIP-seq
MIRT1144938	hsa-miR-4267	CLIP-seq
MIRT1144939	hsa-miR-4292	CLIP-seq
MIRT1144940	hsa-miR-4308	CLIP-seq
MIRT1144941	hsa-miR-4313	CLIP-seq
MIRT1144942	hsa-miR-4420	CLIP-seq
MIRT1144943	hsa-miR-4691-5p	CLIP-seq
MIRT1144944	hsa-miR-4732-5p	CLIP-seq
MIRT1144945	hsa-miR-5096	CLIP-seq
MIRT1144946	hsa-miR-873	CLIP-seq
MIRT1144932	hsa-miR-1208	CLIP-seq
MIRT2041200	hsa-miR-2110	CLIP-seq
MIRT2041201	hsa-miR-325	CLIP-seq
MIRT2041202	hsa-miR-3612	CLIP-seq
MIRT2041203	hsa-miR-3616-5p	CLIP-seq
MIRT2041204	hsa-miR-3647-5p	CLIP-seq
MIRT2041205	hsa-miR-3689a-3p	CLIP-seq
MIRT2041206	hsa-miR-3689c	CLIP-seq
MIRT2041207	hsa-miR-3923	CLIP-seq
MIRT2041208	hsa-miR-4271	CLIP-seq
MIRT1144942	hsa-miR-4420	CLIP-seq
MIRT2041209	hsa-miR-4443	CLIP-seq
MIRT2041210	hsa-miR-4470	CLIP-seq
MIRT2041211	hsa-miR-4475	CLIP-seq
MIRT2041212	hsa-miR-4505	CLIP-seq
MIRT2041213	hsa-miR-4533	CLIP-seq
MIRT2041214	hsa-miR-4667-5p	CLIP-seq
MIRT2041215	hsa-miR-4670-3p	CLIP-seq
MIRT2041216	hsa-miR-4700-5p	CLIP-seq
MIRT2041217	hsa-miR-4725-3p	CLIP-seq
MIRT2041218	hsa-miR-4728-5p	CLIP-seq
MIRT2041219	hsa-miR-4731-5p	CLIP-seq
MIRT1144944	hsa-miR-4732-5p	CLIP-seq
MIRT2041220	hsa-miR-4735-5p	CLIP-seq
MIRT2041221	hsa-miR-4747-5p	CLIP-seq
MIRT2041222	hsa-miR-485-5p	CLIP-seq
MIRT1144945	hsa-miR-5096	CLIP-seq
MIRT2041223	hsa-miR-573	CLIP-seq
MIRT2041224	hsa-miR-576-5p	CLIP-seq
MIRT2041225	hsa-miR-650	CLIP-seq
MIRT2270898	hsa-miR-185	CLIP-seq
MIRT2041202	hsa-miR-3612	CLIP-seq
MIRT2041205	hsa-miR-3689a-3p	CLIP-seq
MIRT2041206	hsa-miR-3689c	CLIP-seq
MIRT2270899	hsa-miR-4306	CLIP-seq
MIRT2041210	hsa-miR-4470	CLIP-seq
MIRT2041211	hsa-miR-4475	CLIP-seq
MIRT2270900	hsa-miR-4644	CLIP-seq
MIRT2041218	hsa-miR-4728-5p	CLIP-seq
MIRT2041225	hsa-miR-650	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005811	Component	Lipid droplet	IEA
GO:0005829	Component	Cytosol	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008757	Function	S-adenosylmethionine-dependent methyltransferase activity	IEA
GO:0008757	Function	S-adenosylmethionine-dependent methyltransferase activity	IMP	33649426
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018708	Function	Thiol S-methyltransferase activity	IBA
GO:0018708	Function	Thiol S-methyltransferase activity	IDA	37137720
GO:0018708	Function	Thiol S-methyltransferase activity	IEA
GO:0018708	Function	Thiol S-methyltransferase activity	IMP	33649426
GO:0032259	Process	Methylation	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q6UX53

Protein name

Thiol S-methyltransferase TMT1B (EC 2.1.1.9) (Methyltransferase-like protein 7B) (Thiol S-methyltransferase METTL7B)

Protein function

Thiol S-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to alkyl and phenolic thiol-containing acceptor substrates. Together with TMT1B accounts for most of S-thiol methylation activity in the endopla

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08241	Methyltransf_11	75 → 172	Methyltransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the liver. {ECO:0000269|PubMed:37137720}.

Sequence

MDILVPLLQLLVLLLTLPLHLMALLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFS
QIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYE
RFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPY
GSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMG
KAVK

Sequence length

244

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS

TMT1B (thiol methyltransferase 1B)