Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
196383
Gene name Gene Name - the full gene name approved by the HGNC.
Rab interacting lysosomal protein like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RILPL2
Synonyms (NCBI Gene) Gene synonyms aliases
RLP2
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that contains a rab-interacting lysosomal protein-like domain. This protein may be involved in regulating lysosome morphology. This protein may also be a target for the Hepatitis C virus and assist in viral replication. Alterna
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022280 hsa-miR-124-3p Microarray 18668037
MIRT2090911 hsa-miR-197 CLIP-seq
MIRT2090912 hsa-miR-224 CLIP-seq
MIRT2090913 hsa-miR-3074-3p CLIP-seq
MIRT2090914 hsa-miR-4276 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003382 Process Epithelial cell morphogenesis IEA
GO:0003382 Process Epithelial cell morphogenesis ISS
GO:0005515 Function Protein binding IPI 29125462, 32017888
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614093 28787 ENSG00000150977
Protein
UniProt ID Q969X0
Protein name RILP-like protein 2 (Rab-interacting lysosomal protein-like 2) (p40phox-binding protein)
Protein function Involved in cell shape and neuronal morphogenesis, positively regulating the establishment and maintenance of dendritic spines (By similarity). Plays a role in cellular protein transport, including protein transport away from primary cilia (By s
PDB 6RIR , 6SQ2 , 7LWB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11461 RILP 134 191 Rab interacting lysosomal protein Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at higher level in lung. {ECO:0000269|PubMed:14668488}.
Sequence
MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPR
VTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNK
MVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKD
AVVTSAKNAGR
NKEEKTIIKKLFFFRSGKQT
Sequence length 211
Interactions View interactions
<