Gene Gene information from NCBI Gene database.
Entrez ID 196264
Gene name Myelin protein zero like 3
Gene symbol MPZL3
Synonyms (NCBI Gene)
-
Chromosome 11
Chromosome location 11q23.3
miRNA miRNA information provided by mirtarbase database.
40
miRTarBase ID miRNA Experiments Reference
MIRT531432 hsa-miR-449b-3p PAR-CLIP 22012620
MIRT531430 hsa-miR-4729 PAR-CLIP 22012620
MIRT531431 hsa-miR-4786-3p PAR-CLIP 22012620
MIRT531429 hsa-miR-671-5p PAR-CLIP 22012620
MIRT531428 hsa-miR-5696 PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21982860
GO:0005886 Component Plasma membrane IBA
GO:0007155 Process Cell adhesion IEA
GO:0016020 Component Membrane IEA
GO:0030198 Process Extracellular matrix organization IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611707 27279 ENSG00000160588
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UWV2
Protein name Myelin protein zero-like protein 3
Protein function Mediates homophilic cell-cell adhesion.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 36 148 Immunoglobulin V-set domain Domain
Sequence
MQQRGAAGSRGCALFPLLGVLFFQGVYIVFSLEIRADAHVRGYVGEKIKLKCTFKSTSDV
TDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTI
KDNGTFSCAVKNPPDVHHNIPMTELTVT
ERGFGTMLSSVALLSILVFVPSAVVVALLLVR
MGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY
Sequence length 235
Interactions View interactions