Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
196264
Gene name Gene Name - the full gene name approved by the HGNC.
Myelin protein zero like 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MPZL3
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q23.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT531432 hsa-miR-449b-3p PAR-CLIP 22012620
MIRT531430 hsa-miR-4729 PAR-CLIP 22012620
MIRT531431 hsa-miR-4786-3p PAR-CLIP 22012620
MIRT531429 hsa-miR-671-5p PAR-CLIP 22012620
MIRT531428 hsa-miR-5696 PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21982860
GO:0005886 Component Plasma membrane IBA
GO:0007155 Process Cell adhesion IEA
GO:0016020 Component Membrane IEA
GO:0030198 Process Extracellular matrix organization IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611707 27279 ENSG00000160588
Protein
UniProt ID Q6UWV2
Protein name Myelin protein zero-like protein 3
Protein function Mediates homophilic cell-cell adhesion.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 36 148 Immunoglobulin V-set domain Domain
Sequence
MQQRGAAGSRGCALFPLLGVLFFQGVYIVFSLEIRADAHVRGYVGEKIKLKCTFKSTSDV
TDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTI
KDNGTFSCAVKNPPDVHHNIPMTELTVT
ERGFGTMLSSVALLSILVFVPSAVVVALLLVR
MGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY
Sequence length 235
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Lung adenocarcinoma Lung adenocarcinoma, Lung adenocarcinoma (conditioned on cigarettes per day) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Lupus Erythematosus Systemic Associate 39290707
Moyamoya Disease Associate 39290707
Rectal Neoplasms Associate 29801473